The URL can be used to link to this page

Home My WebLink AboutThe Estate of Sylvia S. Shandrick - 1988-08-15 • A YY : r �'� l$ � ` 'rZ�r� I: ' lt,:.Jl i�,• ' t '='; .��I ,: t)l tt 'tr ,"1, J� s �I �r (j � Oct. f( 7 •�}c. 1 f�"� r�� ,rx 1 ,1:•., ,t .t 11- - i. ,. ri ��- �,�. _ 1�.1 �,L�, .. Y• .;:�7 r t: .t r t r t �::�1a ''. •a 1 _, 1 .,t` � a t l' � �, t`: �,. _(f,' h� , 1:. j@i �Y1,.+ r C' 'fir -+ 1 r. .a: (- :'ter :, i,:-., t'-... ,. 1• r f! _ .t ��' `1 " - �.1, 1� t2,.. 1 �: .�f. . ,..:,Y' ..:, I!-.4,�1r r J._:..,J .'-.tag. , -..,aJ .;r=..,,�.'c` .t:. _ � .+. •,•�" - S'fr..K ,7 • ,t� •Y..r.. `i• j�.t .., ..� . :,iF' (,.. ,....:-. ,. .1 ,1 i'1 ,.� �-•`.• �?T.` ,'t , -'t .a�' ,�� ^r r r� - i1 t _ ^I' ter !c' t ."," CS tl �:•1 .�f :_ r r. I! r' '' 1• 1 :1:7 „ii11J r' _�... ,.t- d .+.-•ta ._. _......ir aF:.. ... I� ,�i•, :a .f•,T ;. �( +,. r�+. . 1 ir..` : •:t,a ,, ;.''�1< •ii .. •i, .1' ' ,:h J'j .47 �; 1� '[1.. ,;.{$� ` ',y ,�,:.f :� � _ ,: r i , ,l t ':71 ': .,t. '." • •..t:.. tl ,f t •r 1�' .. I r,.�- i f ''� ' �1•,'Y' 1`a •-,, •_. r....fl .� -t:t1:, r, IT ,r 1 ' '` 'L��i ',l �':- ti �• ,.., 5. Ir ll 7. ,'fi,; " l-t t i,1•,: t "",:. "�� t,l tl ` • i" i� t ,..r:• ..,1:,-:, .._-:fl -i tJ.�.l 1 �.1 �f !: ... 1. .y;. •_ :t •s. 7' 'ii��. . i 51� •' �:...`. r,:7. �:.is ..,...�. ! •,j; ,. r. ST 'l�i. •t r'1, ')r��.' 'f�1;�� .w,. :. ,,,, .l.:f•+ :ri t-:,.t t L.. .�{i� .�,-fit' .. a _ 1 „ , 1 .r-n. --. ,7• � •, ,c.~,•i''�. .;• s`, .` t"Y t: :. : •; ' a' , r. 7 r trii . t'• ,�. ,y, A. .Fein x . - ..�• �t t a.' a.;:�'x 1 .{ ` C'+.. ',1'C't•L'; r ".r -, - FJ1 - ��' 'p,� ,{C'g!w.,. �, ►, , '. •� ",t /+ '� A�ti ,.. ..... �:, .«.. t , "" J , �_:f, ! ., .�..+ 1` ,. ,_.,�>... .,.•.{...._.,,. :.....•...,I.►L..a..,s.:r,r �. R ,yt•. •fi Y 3' � r n a 7 ♦ �r 1 14 t{J NO.) .t AGREEMENT FOR SALE OF REAL PROPERTY } BL'IWt M Tim MrATE OF, 0jvxjRZA� SYLVIA S. SHANDRICK, dAMl�f/J��t/�i��T�AI�J�f�� AND THE REDEVELOPMENT AGENCY 1 tF Ar Y ( 'T T f 1 t•Wr��fir ';, f!!L'' ; . ;( ',• OF THE CITY OF I:UNTTNGTON BEACH r <t f..rf F� y a ��t , I�`iF�•','�,.'tr i)�; �j �a�2 :+`ti fit. �,•1 �! 'f rts '^• ' /� 3't ' « �' This Agreement made thi'3 llth day of August --, 1968, by and between THE REDEVET OPMENT AGENCY OF THE CITY OF 7rr • r .�lrt� }tT �if` rr 11 } '1 ! HUNT .AGTON BENCH California, a municipal corporation agency t . the Estate of I1 *! �, i } .► SHANURICK dxtldd/x//s'l�n ddEtYdY&I'd/SVNlidd 7 r , ,-� u, ►t ( "BUYER" ) ► and/r. YrtVIA S. 1r r, r l T;,, - •• 1 t /lI�tIYYdltr ("SELLER" ) ► for the purchase by BUYER of certainreal a property. Whereas, SELLER is the o��ner, in fee, of certain real ore,�ortY r a X.�-aced ill the City of Huntington Beach, California, more fully described as; ; d 27 in Block 204 of Huntington Beach Main Street ' Lots 25 an section in the City of Huntington Beach, County of Oranges . ;' State of California, as per map recorded in Book 3, Page 36, ,�' of Miscellaneous Maps in the Office of the County Recorder of Except all crude oil, petroleum, f,RY Orange County, Cali'cacnia. gas, brew, asphaltum and all kindred Substances and other 1 • T,r` �i f ' minerals under and in said laud. ! r. BUYER desires to purchase said Property for cash and SELLER 1 desires to sell Property to the BUYER: i i 1z 1 ff;,� +�)'3Y 1 r �;,► NOW THEREFORE, the parties agree as follows: 1. PURCUASE PRICE. The purchase ,rice for the real property `;�• ,, i }:� to _ ��"�,.,FJ�'1 t�i•'�:s is Three Hundred Eighty Thousand and no./IOUdollars i 3P0,000 .00) . 2. ESCROW. BUYER and SELLER agree to execute tLe escrow r ., X, e'_o ' d incorporated herein by insrructiOns which are attached her - P 7A? ';� r;; r �;-;R ,,•' this reference as Exhibit "A" and to do Ia:LI things necessary in lt� `� •=3 ;�� conformance therewith. �� t J Yrrlr=t�h44 'tt�)� =t't ,lu^t. �••.J 16 1"L.;, +r rot• rA•,.,r1�7�7 ar.t'�r3 ., •�``fy.. •{ J �r 7 � � •,P . T j � W W. f (' 1 t } I r I ,l > t tY r _ 1 :Y, tY c r' illy 1 !,: f ! �i r, .• ` ,I.,S� ?' r t�. Tr.it !' :r = .' t r ,, :.. jj1 • i•1 r ~t r f r ,:y _ '-+' i r '1 7 -7ff' �, r {.rf = f i a Y= ry• r c _ r,,; C Jr`.,[ •.+ r'i '� ,. + (�'V !1�.} t�T ., }.., `yY �,� Y tti'"r4 � f �: , .Y r x� .t_' ,. I f� r _•r•t , -}r •.t�7l,.tf f�C�R' J.yl. ..� �`�ia• ff � s{:. _, ,.,, rai:.. y. 4 ,.r.•.Yry4, .•..;r.• '•.1'.,'_ r :ri' ' i+!' '' rr.-�`� lr.; l�r., i =t•j. `r sr' { '�t..c,. 't - ^1 r•7-,�,�, � t 7T :� � l�.. Irk t. £, :� �� r ! a• L3. r , r; ''� I.i�( oZ s +lri li ' i t 'i-,•' ..C`r..y p;, ;6 ., +,� 3 �i 1,< r�i�� r {t�:,'[ !� •f fr •1, I '! , t,.!t _ H {r•n :•`t/ t at� S i • '�' , ,,1 , .i ... �1. l .. an' � ;,}t, � 1 .{t+, tt . . :1 ) ';, ',,.1 I ,t .,i1 t`'w.i i. � Ir. 15" _'.' // t 7 iY.�• , _,. 5i , t, t'. is , 'r t < 1 1'l •,._. 1 �t t• , y :mot r;f;��•� r .c.' :, i/' 1'�6 i; , ;y:. 7' yi Y' a IF tr ,,. '�i �} _tn ;s.;r X;t�d.R�Y.:f.i fty -fn +• I r ,,i �;.! ,r.;'i 1 _ r .t ,, •.,'�r 7 ,' L:.fi ": �l, t�w.r�". .;Cy+.t 7.r,'.=�•,�y�St ti:, w- r )tl r-7�;.'1, .. .,f• 1'i 'r 'tia.:: 1 7 ,Ir f r ' ry ` !� 4.,1:1'�t � �1 �Cr.�f.it+�+! 7:..�•�,..r 1 .(- -!;.` Ik .��''t 7: � 7 + 1 '_! ,1 t.i �f:, � of�trjJ( A1:.{"iF��f ��Yii +t, ,(;y�' y '• �rt..�t �,� ��J rx .G.� j 1�f�``+-J ..1J � '�++ lr,'r by ,, - f I '/ S a M f , S =,,Y./, Ir F. �: ne•, t W'�R�'��tt�' Fi. ..;{,1 r q�;:f T{t t•it , ltt r .\'� ./. �..{ {i '��i 7..1.i� �j:�� _.f14'��'p �+•� -.�'�!'. '� 1. ,�l'.'R ;f .i'j.V�+��,r,i`ll�� ' •rk:J.;1� fr iy?I ,t�:. 2T � �;.J !J ' ��dr �r Mr+ t s'�..1'ri�t. �t':&RX ,.1a/ + ',�CJ..tj i'�~••�` F ;_u�S. f� ♦ �:: tl t'.`.: it{r ,•t ••r (. >', � -.lit ��{ r�r ,7.,. ��':rT�. 1 ;,, ti:).,.T �'7}�,Sj ll �-��. ,�`�•:��14 4 fP. + . I j ?i. .tlr r••l�r• r.r,',: % ; , + 'I%�� t.' r h '� r.1t{r t +. 'I,tl � :,�•21. ,� 7}t>`et�i.'��•",•'�t�,��,Y''�'��.r ;�";��3L.,,� �r'/1.�. ':.5�-�i: ' ll { ft /�} 11�, �r•'�1' r , .tr•, , 1~ r L'` ♦, 'i� "+, �Ft r`Ij4} ;t. /�r:r� ,. 'fir p� rcc(tt r j,,�.J �'r` Vr� fT.�:r f� ,. �4'l: .i.. r�1 .Y�r , ' 1! Lt', r ♦ i.,:f t rl7 �; yf ! `• �, r W c }:. i r .3 �f.�• „r1 „'rf'y �1,��►1., r, I t n-+ Y �.��i i = 4 ;'. 1 1 ..`• �.: .''..' l r ,, ,� +, ;'!�i yI�• l•. �''s'>•' !r 1 Tt.. .+T'�{p4rG`mot� " v 'fir -.pf'-7. r 1.►},7 �. '�•�} ^!'(' `+7'I �..'. .'�' , ., 9 •7.'� �"',• �. "U.ry -i i-1s,TCs.,� rr�.�':,r. rat '�-; "� r.. ?�r s�f': '.�•i�•1.�''1�. i r 1 it.1 �J,) `�, 7 .,•.. i, ! +�',+j �r .� / {. .J'fa �L.�r..., I�� r4.t:_�,�,1.�• �,l�rtl�.��i r li 7F �xt,.ti�1r 1„ rJ-n•� JiS `�� r, > �! �. 1 , r! .r�t .S1 (�t}��7E :k.r) �1:.. .. ,.. 1-' .� .•.,.t q.rat.,., . ,, ,. .t.''' , h r � •i,r..'� ,1t�•.. ,,.f:.,,#.5,. .:1^-'L�.i-, rL'.!. .i_,Y'y/1.1►1 t. /. .r�) � 1 1:7 r��.'. ti� .•..t'�� .r'r1 -�; i•.l '.'A��.t.!�..,��t4'.i+ `•a�,,.. r �t,St'�:�� t. r: .'�_+k � .,(.�; ",:.'.,yi '::It..:,' .'.' �'. .• ' ;:,}+ F.i' i r-. '_t, ;.ill 1 ''. ,. r..f;lii.,• , V�,'.i:,,J:: af'rL't. l { , 1 :,t , t.:. .� �h. .,,. „',_i1 .. J.: .., .,,1-, ,.:. .. f.1: ' :-'- .:` , ram` ^� .. ..� - ll �-. .r .\! �' i�tr� �t. �..•�I�j>,. '•' r t �h. _J1ta/T��,J,:;:;,i,w�E.f,,.t'- },�s,:'�. ir.,Yt •tt•.tF�r.rhws.• }•., .,-�3 . ',. •t•r-; -n.,,.:. .., :: ti: th t , •G< <, �i. '!. 1 r '.'t :r, t""�/,(1� :H'.Ci,:, • •t, x /� 4ry ��,lTt` r. 1 42�+..-1� 1/f�, ,.r) - ,. } ; - ., r: rrr.•.(, Jt :Y' � .h,� n e-'.Ir,�}� ` , ,t f _ r _ 'a r" ' Lr '�t'Ir �f �.. '.,• �' fir.' , 1 r1l};'`rt r_• , -'t' - If C� � 't.;' i �[ +J r .3''S�1 '�"r, t• .,.-;, t :,..iXf a ,�•,� - .. l .. 1 ` � tr , �2 4 t t.��yyy tr k.a _•' 'tA' -tt!f.S J.!' '1. y }(-',� r'. �t• i'-y. f1 i'tr t' r .r} t '/#tt ./ .Ta� +. � t.•.A`��.: k(, R.� 4, �,..{;J ;kr ':.f.' ` 1'S 1 -t} 'ij,. ,I - , •: j •:., ' j J�X�� ,,: D' ;;t �: a. hi. � r r „' it ,'t ,� ,\le ,t 7t a.,' q! Y•..Vyf, ��. tt.. 1�,��' S3.✓. r�.-t J . ..: •, ;�I} .. � ''f p rS � ?'t,,Y lh 1� •�' ' - �I, "s�.� ''its, - 1! ,r .l' -• it — �yJ ,. '�: �':� ;.�, J..• , :.,� • T ., , �, , f 1- r __--..,.. ..,, , a./�i ' ,r .1• ��r�, la .� rt � �7'.,r y�/ } „+.i. :..�a r/ fi.,:.,:,�� A•3{'-. .. ,i ,l1; IS.�: ,.. / '.: � •• / •� r. ;J`. �i •'i'1.. ril �{ir:. �.4 ? � 1 + A,A r` -}i:,««Atli r N.v" � ...• ,, ilia I, \i ,. � \a.14 `y ,,t++��r r .tiff^ i:'F'� - {�1 .. ..' h- .-,I .'`;i.,: ,_ .'' 1 . .: _r.- �1 'Ire. - ,(1 r •r J J. i�f.�";i.- •r� r•il, .7* '�/,.e.:•!`•:.. 7 {r"j'' ,,, •Lt � '? �. f• !: � .,.,+ar SK'�` .� ;J t ; ;� +.. r },. r�., .f,.; rij ,,. .7ra• -., _ t. ,,IJ � ,;� ,.�' t`'� ;� t X , ...�5-- ,17 �'. { , , r.fi y •J, r... '`1.i• c 1�, Zl,. 7 1 ;i\-'t� i - f./ w[ i� `f•, �!1..' t t 1r},, '1 , , ',} jful Xi S r� '� y+ it 'a '► � 1 j _,;: 7� l �L• L 4 ly(sy'j� � f' t;'tt !{ iy `t�.i 1.'t.�f'�ia r ,, a f' 4„'.i.-�� ../ % w-t'�`� 1 •1 II. ,t f" •'r� yy � � a:�''� "•.i w, �yJful�M _,, .,•, A *;. ,1L� � .�� ,�' v,l� il, J. ,I l'�1, _(:;l_k tilt^}'•i 4 n1'i .} r, ).' ..tr, .', ,•r.. 4 .', `.` 1• `}? jt f.' .�"i I.r tT. S•{� 1 ,�R_ .'/'�'p rµ a'.'Y ,.. .• .! 1;,51..+t.. .,.t, •i.•' �w1:� •-.-. .;_ ,I,.. 1.., ,i �.. ,} .,� � ,i,r; ,. ItfY. .• :� -. -a::..l`i. +.`4 '.;.,' (, (�♦ t} •s';. - 1 �71, •,., � � � t ' it s ►' ,r. `, �•, tt ��! r.,,r ,�f, �• ...• i .a.:.., qY', .{.r: .. ..-:wJ , „�,.1-.rV, �'fk,t�i , 1: 1 � ;., , tt `,+lr I .'r •i• l' "') �..'' f. :fc: t.. ,, ,..,,�.. 1 �� A`�h , �, t..�h a::•r. 1 r,tt ,',r itYtl .►-,, l.._.�i r ' .,:f �, .r , , ; ' , '(yF ' �'�::;r #�i' 4a;�f i� . . it -"1►.3.,....riK:L��.�.�... M4iiui,....:�..n...rn...'1'�"""`.�.... .�.r.�.4h_+t�-[.a.+..b..i.--.>.a��...�� ,.'�t •,F '�� ♦ fly:.. ":( A i - • +,c c 3. CONDITIONS OF CLOSING . The clo of escrow is r„1 7W. conditioned upon : 7tJl ' tYl.,�! ak L �ITi A' �, +} � a . Conveyance to the BUYER of good and marketable title . .,, rkY, ` aJ �'r r r�, ,,rJ1 � r ' ,� silbject to the approval of BUYER' s Attorneys • Jt ;i ; ! <1 If stir. ;� b. Delivery of California Lin Title Association (CLTP.) ✓s `l -► title insurance policy in th;: amount of the full purchase price ,-7k1�J•` t��5 ' , T;, subject only to such liens, encumbrances, clouds or conditions ash f. ' tir i , ? }r.. s j f ,t�sf�"f.,� r•F � , within b the BUYER's Attorney. r,•v ' ,tJ :. , ii r ;x� i Jr may be approved in 9 Y I� ' C. Delivery of possession of said Property to BUYER or . its n:minee, immediately on close of escrottr, free and clear of all 'tf1 �I:y ! iri�it"• 1� {'_ "sting. c� uses and occupancies except as BUYER may agree in ':w. at. rt. Jt r tl� i r d. FAILURE OF CONDITIONS . Should any of the conditions . � )>4��?A,};a,.`�r �.,�• 1T� ,,�r•�, specified in Paragraph 3 of this Agreeient fail to occur within days after the date hereof, BUYER shall have the thirty (30) y t•�F• .•, ►��' t��r•� 1��-' ower, xercisabie by RUYEF; to give writtozi notice to the escrow �: holder and to SELLER to cancel escrow, terminate this Agreement and recover any amounts aicl to � 'YI p escrow holder on account of the -� purchase price of sal-I Property. The escrow holder shall be, and 1 ;t wl+f f '` J �xr•f" " �`'':< `� ' is hereby, irrevocably instructed BY BUYER on any such failure of conditions and receipt of such notice from BUYER to immediately •' `- � :%„{ i, refund LD BUYER all monies and instruments deposited by him in J � t r1��nJ4(� a�t,r• •- rl�'`�,"-:t _""'fG Escrow pursuant to this Agreement at BUYER's option only. -• , /t.• iJJ.= , 5. PRORATIONS. Insurance, Insurance Premiums, and r aSs � i Possessory Interest Tax. There shall be prorated between SELLER and BUYER on the basis of thirty (30 ) day months as of 12:00 midnight on the date of the close of escrow pursuant to this f Y ! I 4 contract .the following: 'r ry l• T4rL 'Tjtt7 —Z EWA 77, - .,{..'' '-. A/ rJ .+7, i..; ! a•. 4, _yt at .I! u•'•�J�S f y ji r rr.J�J• I ,- "% (/ r',,*r-,�a � v ,r JI {• .t't r I ;r� ,, •„ rr r, .�t•,� ,J_t7, ,,. ,n A -J,,, ii t v: �i' Nt i l�rl A }r• J J •r.._ J -� } 'r\.s`1. '1'' i t t .7,''7.�.• :.:�' t -t`. , 'rr ' ,¢. Y 1•�) xtfeA.. y/� ,;�17. �► lrJ..li(Jr T +1 S 7t ,!/v• ' F.rfii 'Ar, n ] /fk,, 1_ y9 t ./�.S ti ! 1J r /11`/�A. i t T < ;,ty lli�r •1 r �ilS +. �/!('��; t�C'uw 1�r„IS,(`,�1�<� .1 ,.L:—• L -r�r1 ,'' I• •�^" i}''is,a T '•�rl�{r ?!1' •D•!� S t. T' / rl /('jt„r'1•�I,�r •'1r�1. ) LF�� i I �� r '�r'S�, T�.�{rt,e- ,,j. r ,,. ,,{,i: ';'?: °7tTl;, i ,• „t:. >ti #7"•{�`� .;{:ti{.till,,i l.•:�`.+� ;!J:,f , �_ �� ;f?i.rYr J-. ' ,w, �.:� ,.}3��."•/af Q rt� I e ;CJ, f, st. t ,: Y ,� r •� i `,� i;- �. � 1 1, !. r ! `r n } � �i'' •,'♦��E` J, tl:rr �i•' Yr.r f \I { ♦�.:; Ile . :. ; ' 1 t• ,,, r /ir{�Y`,�-, J. }�. ' .I , r rr i t ti.� *.' ! i•t �r ♦ r 1.., r 1 f 1.� 1 c 1 a�tt!�'Ji ;J ( � ,1 °� r+'' ! v- ZV , i;�, T, f tt. .} fJ ,a 1, ty .7 lI^ 5•f ♦X;�.f.� ), a v, r J A I .• { ,� t� ,f i Tf,'"r i I 3 t • {` r - ��;,.Y_il ,a•.� ,. t.h i tr.j r -�X 1 /F .� „' �: / � r r �;t Ll ,�{r�i. lht \ lyTlr,';• f?,y- v �., .,,!J ..i•'�j.(�'� :'a 4iS i'.i,�l� a'.4 f ..�. �rt't :.,fy(� t ,r.'l lit 1 1 �. i Li at ..L`��` jr^;!a.w.,.T r !�'j r ` .4. 1 t t'�1 a h F.',,/� J.:lI^ 1��3-f�L J�rl-) y t. ,� ' •/1 J pp ! -t , t i r rr,' , 4t 'kf f }'�,C[` •.',{'`1:tn"�l,� , Ftr,r l.i,,,l�flS+°.�!yy., , I r l t�,,, l� t��.. I f. 1 .l. iL t t / i,_, r , ', f J.•.l 5- a („'j}, ii�t .� jl.�7tri 1 �"�..`.r l �\� 'tf .�- . I f , �,t ), '�.• , t ,/�..ir*^*.�r 1..\{ � 1// t>. ,! '' iJl''�'r,• �• r1 ( x a t GL x ,' • r '• ih yr i!' + ,.r f '�.rlt t2;rC�t.x�:, SX.{�iia ^� ,"S � 'y1.. I ( ia�i ,` Ai• 1 1 t r��`�� ,• I;1{�'. .t ,�.ir ,.►•.�`t (!t i, {� ', �r l y � �� * .3J ,�1 :: �'rrJ•: rfS�r�.11j ` r.)i i j r ,y J 1 2Yr{/ f i� � `/t .�f;iY4i�'4 1�.5 �5 y�' r �Tr � � 1:!e=lit,.)A•� �4 •: r.,�', !.•:�1, 11 ,,�: r /�*• � ! f'i / :fr hr� ,a rA7.''•'f 1i � ,1( r/tom It�ly�'4i ry. , h 1 li�{,!!•, '.��'. R f {,,.: it �rE' 1;� t' I ! +. l , 1 1• r 'i A �i ` ; " tI•fir•. .3�,�s,t.'Ys!r i`,{. ,y'a'�' {� i' J i , ;i : ;>;� s• �' �, Lt f J , Ir�l 11� f � J L ST'•f ( ry l i a7' ,! :i ♦Jr fM+.2 � / 7 .Y :t � 7 !�._ `�,J.J'ir. A � ', , ' >•' r7�-{'a i"r /� `:,�' • { 1:,l'�i r'/l; A I' •fl/r?'i J it t� r�'. .'i i st,� f.!,J"��,!,t.y ., .,,.Yr.. r h r r• C? 'r, ACt i -- .4 t, ',Tr",v rr. lr. J 1-. ,.:,,• r /rr1.�ry � ''.'r.�4•,;,r ,'q.'t ".. �, ,,{,• '�,� ,r. r A F,I �,y pp�' ,. y .:�. rl ., Sv.r -..i"!�� i•,'i.{< r� 'r�1 r ri J, - �.r. ,A:�f ajrtN t .r r,f�tl}.?S- ��, tv4. i t.] , 4 ,.4 i„t>:1:. sty-S(•1;ti . _ .. �,_, ., ..,; -. ('.,`- ' . : -'•t f ,, A., A. It � t'>�•. f, TA{,Xr'•r, r'„ r tf',�f � .i . M.�`r.fr`,�}J��•/..E�,,�t��:;t, a f.1�.,- �r".'.ji�!/r.{-1.' ,l'. f r• �f.r .. �t ''t - }>rr• ;'{.. ., `1 ¢1a J.•,j�t`-• vt w,. rl '11 ' ..�3�► !. t4r t}r�. ;�l � � +t.:J I. .. ,+ . "i+#�'r7 '.`:•...ry, fS`o;,. ,� !3 +,R. f r(+�!:J�L r '�1� J. 1• .. �1:- ,t-� 't-• �k}«i ,��q. � -�!+'' ��". r SkIMMER c jt`��rL:t �`T , to .•1.,"� ,. , (�. . � '.':. :1+,:.r '•; :> (1. J-{'� =L •T /� �' �•' 'Y rl _ +. t t:'7, r.,.! .i-i:•,i. � ', . ,,, j .,Y li ,�. :I ,(..� Tl •l, ,S. I � 1 . - }-.U, -,� jr, i r i i! cl�. ��,}.' •{li "�l. I, �l�;-}�'f r1 }1 r ':, f f *}M `7�',.-' .Qh' til y,�' `' ':i-ja / �� / �'}(•�� i. f�tlJ t/' it i' '�' �� (1, 'i :�� _ '�; ter: r i}, ,�tl 44 fir a '7 ":" ., .� \ ;*:.'.-:M' '�•?"'"; "+., I r.�: .51 'T r� lrrl ','i•r 7'^''. 0f'r. ':V. � +r ,,'� '�r ,•3 'fl•,%(�r1=.. '� � 1. fl ,.., { i �` ,��i� , .! rr. �) Y...Jj -3, t •�i• `�1`� .,� ...r" 1{� rJr4:1S ru ",�{ .'�. - 4'2 T ,. ', ,. •:. � y �, li , t tacky 1 t , 1 t• , _, }� i •'s; r,. ... +., .� 1�., -'-+w Ji 7C. 1�♦ ,.. r -�• ._: - Yl,�1,►r .� .. i. �, .1^ r J.• ...� �,! .Mira Ir•fl 1, 1: :T A t �c i fril ,' s. , ,; n YI 3t � 1 IS:1r'"t /+h! fr r k r. } 'ta "� �' * ''?�• Id 1 ''• !�1 .,!•.'' I ;/ ;r, l.i yy J, aCl + y i �' {i 1 '� r!' rrr )f c'i r�. t t S t 4. t J S�'�: / I r 7'•• G. .,. n ;` � ..,i._ -,�,.t, ;. ..:;, ..,• ,1.,' � �i'.� 1 •:. ;trit .ram~ - t'- C.f �'i-,.a . '• ': ss r r .'7 "fh�'1 �r�,' 't�j}{..b�'f �.... r / . .. „ <;l.r h �',:�ryr•r ' 1,5 �� ; ,� +'� r �}1 - ,,� 11'�,'rf aI�SY;' .bi '}' I 1 f`I :,s�' tJ,- •�, '.;1 L"`- ' - '� 1'1 2�,:1; 47 .. ,l ;1 ��,. "} '{i };( '1 :N� •�l i'.Tr+• ��f � /�s� A :,'}� .: ..... ,, y mot, �, S, .:_ •1 '.t .l �� % S ,�; � {",�1�Y. �, i �.., Y..-,��, ',.(..` r-yv'T�,r{rl. z., ,' ',. / . I� i - .I Y"• /', ,�, - 'Sa ,y�� ', '-.,� ,•"{ t.r i' ,. y�`�`.::15 t-rl:..r•, _�a -' ".:�. � •! �}. 't^r.. C�'1�.�E� -'-1 !-• `4�'« '1 � •� Sri':#�a.�,"�' r ''� r •:'�. iy � r tl { 1 !77 !I� t�•. �S - �{ j �}�y1. '� � .h •t � � ,J • `y.l�•,;�.t� , 1a..-:, �?Cy'`•,,. W12 •1 ! {1 � ► `{�1�;.• t ,.�',r.,,i.l::�' +:.IrsatrGrY ^•�.!a,.. '-iryy.u.�i-j,:;,• 'r'�F3.:�.1..� "et::J�'r.r..�i.'.{i,.1 M tw.; ♦/�.• It' ,..;y `1'• ,+11J.•1 .ar Try - ..� :.;.,.. raj � l !.• r • � ;fir' r S I t �•. ' � 1'+' y �•. ./ �, 1 } Real property taxes levied or assessed against said Properly ( including an} water tax or water rate Jevied ;against '�y.4 t _ said Proper rty for the furnishing of water thereto) as shown on the y n... aX is lrtraii' ,t�tj� + err, latest available .'-ax bills. The County of Orange by law will , ,<<� i refund all tax paid by SEL:JER covering periods oubsequent to title 1z :t vesting in BUYER. �' �� 1 >L, .� ;fi;t' ,r1` ' '• err. , tf �; r: b. Premiums on insurance policies acceptable tb 6CX. �r}sl1.ot, A Fk 1. f insuring the improvements and buildings, if any, on said Property �♦ �• IYJ 'lt•.�' 4 against damage or destruction by fire, theft, or the elements. : 't 6 . BO S AND ASSESSMENTS. Any bonds or improvement {� A..►f1N 11Z 1"+t} ,ir' lOt r1; assessments • yhlch are a lien on said Property shall on clone of esccaw, be paid by SELLER, exce 'those liens imposed b the City r , P ' P Y k , t 1 �► ��;�`; ► JJ of Huntington Beach or the Redevelopment Agency of the City of l` iii�� y 1 ti h� N !, 1��A Ky � '•' fMi Huntington Beach. �•r +fit rw� �,�3;�I•.� 7 , BROKER'3 COMMISSIONS - ATTORNEY 'S FEES. Any and all Xzj' ,s� „nr ;► '�;' t finder 's fees or commissions due to real estate or other brokers ) and all attorney A 'fees as a result of this sale of said Property '. s� a + 4 ;' Lf shall be paid by SELLER. ;fir 8. EkEENSE,S 06 ESCROW. The following expenses of the escrow described in this Article shall be paid by BUYER% 1•• R�Yn .� a. The full cost of securing the title insurance policy described in this Agreement. b. The cost of preparing, executing, and acknowledging s • rr, any dee3s or other 1,netrumentn required to convey title to BUYER or his nominees in the manner described in this Agreement. c. The cost of recording a grant deed required to convey title to said Property to BUYER or his nominees as described in this Agreement. r• -3- Y V t" r•'�'a� , a,J li! r � ' i tri i'1.-' } x �: , ,.r � � , S �••,r J t L"'r.>; M t .2:';'.,. �r:r. ;i Zj ,{'r r Ir t N: ,� .F '.1}r+ '} �.�};rl tf.' ,•yd, .:.f ♦1r� �,*' i,?,: k1'''h +' �., t i,•1� ' S ••v yt t t,.'S fr s' f •.'•1 J J.: t r r� t+,. } ` ; `- �. e+'�L, �,\ J}�' lE� 1 tarp Ji t tic �t r r }r J .i ?r t �` - .+Jr f. S�•l„ r +r rM 1�..3 a.�, rw �} j/ Irt. ' , , t q.y"�r,•f,•�i.'•!7`x r l r•r,i f s Jl .�' r i'r r r , {Y yrl�t a . 1,�r {� t l t }A•r t i ,•tiS j ri"1 �' �c:J t� � _ f�.' rt1.;` ''l+`-a•' lt.tr t+r`.i � t 'fir r.�"^,,.:7! ! ��y^1�1 .',� 1, �;: ".7L J� � .F`f' j+ll,1 , �{ ,'+ � �. ,� y�♦•.1Cu},� r �tJ �}y rJ,.t e:! 1 ,_}.ltr t t.. �. ,f @. ,r . -:�'1J yr ,U�. r' vCfF � f�j}� 'Ja+rl . ' �i,.�1 �►`{r Y'y• �3, �1 ' ".3 r l}i L I ¢yt�t ,, ' ' oa 4 • 1/ t { 1J ` + \V{ AFti� r '�t r? t� . /ti 'f 4 7 e r \J f • , Jar fif1r ,�; �';�! ,}� �}`�"ra,f{�" ss J t. ' �, ',,t�Y}t'• �� ;! f' ; �^" a``��".r,`! 'rt7 ! + « -r trl fir , a � tr S 1j ,' r ;h fl��•t ,tYli'p r r, .Si s' r{ 4 ,. f 1 ♦1� ,l 1 •Il 1 1"� 1 1 i= r t +1 y •t�'% 'r c* f' T j � 4 ;,� � , t t' 1 7a , 1 r �1, ! 1•J :7r < .✓ i 'u J ti ♦� � 4 r4 +r;itt� a)«{mil sir"3! r I f , J ;jai {> , r {;'l i� f 1>1ty ittd' W ��i'i�,, 1>;r�' �t�,J=7%�li "Jr r i l rarr•`�+`'ff t f�'t ��+r`• r 1 �b'r �./�} 1��' `Y�hQ+?�"'� �1, r:`:, 1!"tijr� �''/-+,f'Y� r,oar t t�,r rx+E �M4�Zs t� rr 1tt.r1�til .i i t '�ti i r• K .i rr, Ct 1`i�t h+l ='I -f'�,lr�i"�s`j�t ', '�lr}•f��'+_' t t ' t'�� 1`�- S•• •+ ,,'�'1i' r 1'' � �tf��•t �:i ., i .�c err:r y,{F r,,gip ) t'r r• / f 4 rr,,'y t j c,. 7i; r� � r �- r f ' t '', k rsz.�tf.r yt'� �� ,. T 3` h r 1 r, t�f t .• ,hl�k�}, !�; ,,1, y>^�([�44r �{�'"{/ly�l�r �S;T�t'1 t�t.�3��r/,:�� •` '4n�; ` � }` I.'!,"t, ii..'...r ( 'eX ttj��rJ �• �,AM. 1-�y •,I t {C•a f IYrT; 7 f(�I S�fyat� � ' 1 , � I,tl .� .} # { tr, f^,., 1' 1� y �_\S' ti ..!"',,.' •i�,J. 1, ;1�: }�' ,nt l,l. 4• ,Y}., t' . Ctial t .1' 1 r J �'� ..1...1. / t, !r•r' /,../A t , 4 v'' �/ j' �k al��.. t.• 4r ♦r•,t Y �J.'S}"1 3•I r. � I +,,.�•] i ,..: , • 1p r.,r 'f.•rr; 1' « •I,r,;. J. •yYl ii i,y;r�: - 1. �, r, =p. .:!!)it+{. J y ' {r�t - •rt�r�t !1" .A . ,f. ✓` `c j, s �`'+�,t!+"� 3C.i«Y" /-!..<'- r • '�• , ,.;... r( b4v 1 Y.'•-;rd'll, .� il: ;' +r 1. { " ar`,�� r•t 17��1 .=-.. 1;S r 2\ �t . y,; -., '�:,:�G''� :1.'',/7 :-. •I� r :C t tl `') �{ ��t ... ,.•`lly�f��'• S jfr ,1 t .'�� Y.- r- r12' ,1 .,i-, I. • :.. -•yl: ., r • :. n.. ,y ,.))lrP .' r! i -i , ;1:;; - _ i 1 �. Q! �}'� .Sr,.', - lb :;1 !��'•� +� ,!+'' ': .fit• ,.� •,, irk•..,�,,�",, �,':. z� , '. i �'� �• �'•s I .�'S r , �!.4• fj;, .{ .':.;.` r.�\I • .,.t)l• :,:.r �• : .a r •.r,/, i ".L1� .1�� ..1;1 }� f::• ) ,fr ;/,15�'.�,,([ t .,, tr :��: ' -•, .':.-:. .� '.�.,� i.'...,,, .r .. : .lr r IC' q.} �+1 ,. �I'i�. it} „ ., •,� ! 1�'+}�} -i '� ��.1. ,f(�" .„: K� ;-.S� 4c;lYf ,!. .:,;. .1t, ,. 'r' •f! {, ! r � ,'•'1r� �t r f- , ,�, •.1=�i� ,:;�'�,',r:<:. ., .� .. -._ ,ji; .� 't.. ,, �;�, ',r .�,ii' r t 3i: J T'�s Y}•yr: d T•7� tri�:,i Itr: { ' .•,>r �', . ' •r'`�t" i"1 ,q`•x `�•:' 1 :• '.r• 1 !. .rt; .: .t.'.,tt y , •�, '+" n.,,,r•.1' ;,• � t�i•�� •t,; ,� ,`, f , .. Ir 4, ,! ' U:, fti. `},' {�..1 Alt' t > :�•'�iri '.`df�• �` 'it'�� fl , ,, c.ii'., i •j `^ + ,::i r,.t,r'i,,,^•, .l�'�. (1 •,'. r :f 1 `S' ;, ,', S4 1. , :r,�..Cl,^ ,dyr ;t�,. -•.•:. :;,. ��5, .. L .: ,. �}. .,, -. ,, i1, f �11 ''? ter , {. t, r' to� '+T,i� ,t. ., r`� oa:.ti1 ?t,7r N � ,,,.t ,. Y, [` ��,t ,, t Jr //r..' 11y�,r •''}. r>.�: • � 'fi..iw,i r�fi,, 'C1.. . �•, ,, 'i rf r I `•i� '•' :ji.�- .�'t:� it�.l t'� { �,�,y;,: ...; ::�.. "t�• ,-f '�� t .�' ,;. ,.i j S. ..�'.. l chi,' ,t l , :i r�f• r �. :'s t s f.-,1.Fi'r! �.i,t ". �t1` ter:' i; ,v' •I !, .: ';.,- ,:,.T C' rt• _{ !) Ji. Irl. ,a.,l [•rrr;,S�r •,-,�f.•• ��: i �1i�,.,1. ,: ri ,; t� •;i.r .. �� .f,,, :�/ , j• t•f• � 1_ q b } ,.l, SJ} '4 , In tt 7':: , ��` ,•� ,1 ,•rr r� : .fit• " .33 ,th. ,,q�:'- ..!'1t , - .:..., ,r, - Ilq• 'r - I"jrl rti:" rr,v, f. i. ..� f�' :r' �'�••y%lar7 J - - - 'r• t` r� +set_ ,Sr;� .r,"rti,�r �. 404 aw .l f ,n, ..�1t• ..,( , i,.. .-. ..,tu.,...., � � .: rj'r. •��..�:• C,' -r: Ai •i)• , f, s /. {�' t L yy .i. ,.,:, , ,...5�} ,, •�, •: ` .,,_,., . ;: ,. ,. . .� _, �� :.r' yr.?,. +i� .1 i r! � '� � .i�� ; • q - . • �,•y._ •'NJ1.1',w ��[�• '' ��'' '�� y l.sr , '., �� J { / " r' !S l:r! f.i• T� j :A.,. ��r:,,,,,•+��,�•rl {`��S,t,.rv,� � .w' .�, .l.iJ��d:Fre `1�,:, [�'S�s; f .,i..C�,l..na'ilrF�i�` iY, �`r'�6.....:•i ,r�'�-..CuJ:;I�. �' ,.��' 1 R1 .'.i -•tu „�. •.'' ,r tip� 1 �i• .�:�.�az ::�f.1f.....4•lI'•:.:.w9f•I.�..t�,.w. lil. r; �Cr +. .rlu it*�, , 1}�"'riS�t ! ' , , . t•'w}i 'r l�l}l '. 1j� t ri f.•• t �' �{ d. Any csCro�� fee charged by the escrow holder int + addition to the cost of the title insurance policy. 1 r t r it tVT } '{ 9 . OWNERS' REpRhSENTA1I0iv5, .OVENANTS AND WARRANTIES. As an �` ti t� y � ;F r S't lr r r. ► r r'L'iJ, �, ;s; exprese condition precedent to the Close of Escrow for BUYER'S ' ;; ; ` ; �`;'' Z.hp • ' i benefit, and in addition to any other representations ; covenants and garranties contained in this Agreement, SELLER makes the each •-11F:�tj ,1 � 1' .trt ' �`, a 1� •� i �.�� • ` following representations and warranties, h of which i3 true in <"4 all respects as of the date of this Agreement, and 3ha11 bE true r r in all respects as of the closing date (as defined in the Escrow Iilstructions) i ,`r.x k(7 j •,r �i'� � ',< a. Authority to Sign. This Agreement and all the r {+'��rtt'' l' '' "'- executed b the .*,ELLER that are to be delivered to the documents ex y 4• ;` BUYE'Fi at closing are; and at the closing will be, duly authoriz�•d, li ''�- °':� t° "?�' executed and delivered to the 9UYERF are, and at the closing` will `� f•'}�K�> ,:, ;l `; = �.: bz, to the best of the SELLER's knowledge, sufficient to convey ri:�'` a title if thay purport to do so; and do not, and at the closing will not, to r•he best of SELLER' $ knowledge, violate any r; `.rrt `7�rsr�4r`•�s1 provisions of any agreement to which the SELLER is a patty or to which SELLER is sab;ect, including without limitations any prior �y v rI.'4 ��•F options, purchase agreements and/or escrow instructions. b. Existing Contracts . At the closing, there will be no outstanding contracts made by the SELLER for any improvements to the Property that have not been fully paid, and the SELLER shall cause to be discharged ( in such a mar-:per that the Title - ,1,; Company will not show the 1iei.(s) as an exceptions) to title •. . , { under the Title Policy), all mechanics` or materialmen 's tiers �E "> �+ arising from any labor or materials furnished to the Property t. prior :r. the closing. , tb -4-• - !' '1' • .r t.!1j'' r \ 1.l.��til'' i�.`. �L �:� Y }! 4j /.. . � • • .''• , ��;�� 1 f •!.' I.. }�yr>x 1S j`,�..+ {ti ,,, 1 f f�� , ;•tr !f ,i.� t -:r r).{ i �t i � rt'ry;, ! ti�1 � r• ; ,. .l,' yt^�.' ••te !,•�Yr;',f,t.:. , R/ , j71�tn•!'71 . t/`.i.•`�•.t, 1�'� , E .t',••� � t• l. r `t �"tr. `~'F r,�rcj t t'•, .. /, •', s �.ty I�.• ,i .irr �',:.; �•�S �y •,lJ�rs3 ..x••rtrr•: ,�,t .ii, :., �• ..i. f� l ( �j • Al"'a i l / `wt•,• • r Jt► 1Y•'fixf fi �'•'!' }� tt: I � � t17 ' � � , 1 , i, , r •7S 'f ,1•.. � 'iJ. "' �1.� ,�J ,r' � fry: 1+�],F'�• { 7'�r�y� �i 44 J (' •a •. 1...' � t 7 / R ! '+1 � _ /! ) t' < :r f S J I tfr ,y:.l , ,� �• , ,y" , ti .,} f�S,i f iJ:,,y, [,,aZ.ie •r. t�� ry,�1 r r. "} �;>! � r t...,t 1�ft !;,r `,+`Y ,I� t', y1ti �,.. V§, i I ��.. ,�!- i� ,y�r: ,� .+' ,J��7qq��rti, / `J•i I i�t,.'�,F' I , }t�JI ' 1 T i 1 F> t I {..t' ,�,S'., �..r��q�I F1r��'x•ir.l ,• _' ., ,}' 1•G ,L•�1 1`*f: ( 1i '1'tl �'7{ ,t, t \ti'« �i r ,' ' J ► ,.t' C' �,,tt l )/�•�r" rl� !�Y �i7.�J�1f.�.•�)♦rlt�..f.l•. f. :ir 1 "�, }li.j...�\ ,,. •.j • r , ' ' r. �l!�,1-r,�:r .II ,,{ `',YF " St :1u �7..y, ,J h1 • ,r ��,+ti/ i f t>}'rii r'riY i:�,:;- �1� ,r+�` +,.1� !{�' �� r � ' , 'x� +J� i' v � �':��}41:�(�� +.� (fr �� ll1* f r. r . .; ri , t 1 rt t r ( ! r•� y t .1•f � 1 r '}' I�T�µ lr►!;{r";''' ,1tiXj`; '' , 'G• r �{Z>'Sr '�'".!jrt ;t' i l":` ."t, , t. i � ti, t, � ! _!'! J"�"�r.(q• � �, 4k t t L•1 Nr� t,f��..s ,� l+'J,. r .it�?�, {[Aa�f'�` .r.11r� ' S�ilvrr..1S'.Y5',try/,�,�} ,n f , * 1 t • ,�,..r4 ri:.!rr ((3' t• ,.Y f q>'litt'• ''i � f.�`it, It _ti tier.; ,',..:.i Xr' l•'-'�'r � f ( � r';�'tl r,, s., ( ir'+r 1� .r{�. ti, : I�e„ Slip .�v !1•' i r } a:;l C l�, `ti�1r• }!!t•} �'.1;r,�=�l ''}f jr,-:dr`I!l ,r7 ,x,1 i1{Ly',(ii '�,.t :2ri!'�y. ,tr',-t Kr jr. n , f ii i 1 • i ,., 1r Tr ti" r , '� •� � R L �'.�f••�-�"��{,{7 �'s� Ci '4t+ • ,i �j • vjr \ 7,�•Ye5 �,.: Yip{ JJ �j ,r rf, r;�, ' C• ,5: rl ftf lt...Y� }�Sj+�ti'y�'�yj;�}ti!rt!�'r' �t ,i ¢r /tf�? i, 3�� Jlti,` tr+ �.z� '+ ;1•E3, , {'' `t (�� ,'{ r7r l r i" .f�it:r•r �:•')�^t(z:lS: ^/+'Si i it k.,i t 1?I �I} err '7.71(rr ;+,•S fyfytJ' j w;,f7•,,. fin T r '4 t it t.,., '.,�i`, =''La ,l .. i r ll_� ).•...yyh, t '.r� I •.i f•• ,t,,,;V A. Jr { i!'r,t 1 (Y(1 t t r r HI r�7� y.. i �1•• tti�{ i rl r f '}� K! 4 1 Y': 7 1} `q.r1''1�,7 ,� 1 �. �•, r t h .�; f r ••i, rr r , ! �r1,1�..:.lL`'ir i ,,•,.�.'.'` r,l�l irt�'r ,:.'Y;.q l,;,r,•':• hf•„ � , ,.•,fif \.r!` {,y ' r/ .r;rr'►.S, .lt+ �+r}{;. :IF F�,?"4`' r, +tiy) •rc�rrr}' �t�".t•ISf•� JJ• rs:K _{� 1�l �r•�s ,..�'. .:r, tr :.l , •C. J� � .•' �' t, tI'�;i .1 Is tth :,�1}tf I W, 1 y /"{� t!. �rl ti, r: 'j 'f � ' ir' `•-•' 't �. "�' 4 1�''':i t ?{ , r t . t ` :. ;•7. ) .,y .f4.r'f .�',,'1 ��1 1i.t: r ,:i,j ,t:, �f, t��,t ti, tt ,ram• 1' �.{1 , r� ! ti;;'r.��+•• ��,r :e:;��r�.�L: 'F.r ! ••J.- .,�,., -�. U'� '.1 `��:.. !f l ir, :a J,, ,- , ,;, l j. ,1r �}•r ri �ii;' ,.r -. Sfi' •:, - n ryr�i}' , ti.:t.Mr rY. `� • ,:'�1�'i`t�1- E� �1i_'*•r•}-k`�f�`Y�siit.:, rt �.� �t '.,t '..� i..,�- r "F+ -.i. •��AI .� -•, k' ... 5 '. r{7 2YS ti?�r.. � ,, " .• /��, ,t . J�, ) i 't at1�7 f is, .«�, 4� ;' ' ,, ir:r;r ��' �'', r. i , •fit '.:' �t •! t # Y '.1. 5,�.,r n r y b,1. ,.. -e i..,', :•t!, il' /., '. °, {r G�'• .. ' tl1 _ •f ..� .r.j 1,. r :• ., ,,,�•� �.•'� .( � �1., ? ,': .. .... :,.. t7 ,� :,� •t L• y rr�Zl , 1i(! !,> l. t�k-%y '7.>, - � . ,` �' ,. ( :, .,R '•... .' „ .�f- . ,' i; a, r;.c�.r+ ) f 5.; t sj..�.S..- N, t '' 'v^`,..r.' .;:36..^:: :R,. ,��'-'' :.., , ' {�, ;'. _. rr' . )J� 1, -! -i# ,iI t. .) t 'l'. jy :i' } _ .•,e.•.e a .,!4. .a(-,, Y'r..y:.!_ { 1 s't rC•,r. A t tl� 5: :1k► l; 1 L "„ .- .v...,►; r .: .. /' �'... -• �j. '; . . .:'.' - :1•; .ill - .�•, �� , ' "-.' t ,. .t .. _, _.- 1 , ` ,4•;. .S r:.. tt, )]l� Nc, 71. .,.,ct h.. , .: �y ., .t r. J . .! r •'^, - �• 'I i "J1> � j':s • l 7 ' ��- I 'Y e ., ! „ h t _ •�,+ ,�i. y,1 J :t4 rt`y• ,.,., 1 .,,)�� lr.ei j a L j >. f ` ,,lt�br .♦ t '�! ,.:.;.. ;•-'..- 1:... ` •1 cL' i'l it �l Y 1L.. �7 ;_ :.)� , 1�• qr.... ,• }} �i�i+, r l :k •,t-• '-,y. .� �t,i { '+' '�y t � , t. '� b.•Ty� t r :, 1 . ,•,,.. ,r,.., 1i,.. •, ,. '„ �- ,. •` ,. ..,../�.,.ra .,•,r .-_ ��-,. .fl•,�-' ,�.�jp, , r. i, } f, .. f;�k (•,. : .wt .'� ,ri-; -', ,/�`'�i •i� 1 lS lrla jr# _,(r/ ;/ '!w J�,�•'!'�. � � �. 1 1iA. .« 4a.� ..�: .. .1, •.;: :. .. ,If,., .., ' , _ ?1tit �,,;. Wa i• ;f �! i •,' + , ,� ^r;�'� Pi" L 1 • i+ ! . t�, •r,.' y^y,,. 7#,.i )• .a� �i ;'}: ,�� Lq s rill 1 V._ ..,.. •!!-. ;, C!'; r� . '':". {: +• ��:• �+dry '`1 `r: 1� ,,. ,�, . � r _ .•.; .. p,_ >:, .• xr �_,�s' .r' •r y' ��' t.,• �`' , a •tif't>-;'.•, t ;- J,,` .. ,Ila , te•, . :.: , , r�•r ».. ::r: �.. ��. '"+(._. �_:� kt�.li, �a r' .,, ,� r� 1 .Lt.? ,.%.. .Lt#rt .�-'• ., ,• " ��' >�4'C tt��`.., ....-. ._,. ' .: .. ��.....i.nr.�.-.,.-.ai....r:�.._l�..r..wr•. ..... .-1..,......iL..S.:.,:�.r:r�..k•.(X_it -. ...�.+ �.�' •4 •t ,l?t�',.. it V. k Ll i�, it L it ./i«."fSlt.yri...lsakS'��„y fl.k is dr {� sJ�px l?- ?,i S y ',,�!• ti ;t7 ? - a . ,':s if ( � r_ , ILA } _�._ a� '-.,�i� •�, ` �� r '*:� � 1 'ytt ,�.i�.� { t�� • s,•'y v;t,5'e L �f •�j �� r �k i,! ,5 vt, nY�R�,t t'•il i!'. �,y p t: c. Title. SELLER has, and will convey to BUYER, . good and marketable fee simple title to the Properly free and clear. of t� •,� ty tt lo k lrii , i ;ter t d i i b all liens, encumrances# clams, rights, demands, easements, 1 ;t, , �r !• ' A' '`•� ({,}�� ',f t� r� ► J.,i. (i*,k.# fl,l { rl ' ,'(ri, 1, leases , licenses, agr.ezments , t;ovenants, conditions, andkr ;u,'� �rr t ) .•j``�'i,�a.! ;��•,r�' tri• r ?� - ` •-' 1{� � ' �t i •f`rt , restrictions of any kind or character (incl,uding, without limiting 's j {�t= (, A ':y li4 '� - 1 ■, b' li a r`k•. '}, r a �tll k.he generality of the foregoing , liens or cla wims or taxes, j,�• TI 1 .a� r rtS. Al� i / 1 �, ' mort,Iages, conditional sales �on.:r3cts or other title retention t „ r {t i t' , r+ �� J J�Vl1F �:,ti! t t <"tS� VQ1 1N•' t' agreements, deeds of trust, security agreements and pledges) � {'}�p`yi";i;tx .j ,1 r .� �yZ i. 'i'1 ,s 41,E t• 1 4 Fl M 4e �.',i,-A'J,. t ` tj ' +1y' ' tt�l,y except for exception numbers to title shown in the assessor's }4 r ter �ti Parcel Number 02rr-147-10 Preliminary Report attached hereto as , �� ,►;�jt srr "#� , 1r 'y Exhibit "B" dated July 15 , 1988, which shall be replaced 1 �� ",,r '.•1 -.` 4, , ' f '''•, title insurance policy as provided hereinabove during escrow. •.;t� = 1 't x rl'i t C r. I ,,, rrl; 1JRLLER small not encumber, modify or diminish title to all, or any tw i't'` '+firi portion of or interest in, the Property without BUYER's written >�fSly4t4 �}� l�� t' t- ` ;u ' : consent . 1'" t ill r • r. :, d Litigation. .SELLER is not involved in, nor does '}� ' y r t SELLER have knowledge of, any claim, proceeding -,�►; threatened oil 4, S r1 it 4 ,� �,,`'�i',i`fir"•. r r: ,: .ti , t*I,- litigation, administrative or governmental proceeding' tir 'r i ,,.•, 4Vn L iy`i{!+'dfjr investigation, relating to or otherwise affecting the Property or r 7 '`.•A ll. 1grS xlai�tltit i j ,>r,.ytj5 AC.' .'•'1. i J.,j the ability of SELLEP. to deliver goad and marketable fee simple title to the Property to BUYER. Tenants. There are no tenants on the Property except those approved in writing by BUYER. J-Kytii 16.� rlit. 1:. f. Hazardous Waste. Neither SELLER nor, to the best of "' 'I Ik, SELLER's knowledge, any previous owner: tenant, occupant or urger of the Property have used, generated, released, discharged, stored fi�r!•ja� or disposed of any hazardous waste, toxic sub3l.ancer 'ar related ��►L ;�� r'~•'t t''„'• '` materials ("Hazardous Materials" ) on, under, in or about the t �► , ,• d �'� ilft� h+Tti' ' ' M r , �•' 0 i �p':, .�ilr:C[•,i ,'��r D. j i.4fT'tL :.�r T.� k,.F•C�4 tt �•ft.� I,y i'"v,2 i -f?',( {{� r 'f r •'.- 'r., 16 ,a 7 , 4 i,. ` r-r ;!• t, 1h s li l�F 4wc .f. �,..1,6,t' s: ti .lrS.,•,�,: � t• ' � �i' +�'.g• �' j,ylfai i n' , `.,a•t4+ F.'t, �,�' ::5 ,,(;; -' �' �.rM r ,.�:.^ ` r tt�. yy{ • . y l(.y/ t ,,rs• t ? ,:tip` 3 a , �. ,r.•,1 , L.-•,, r , �' 'Y- .lS { fk1,"""'1• .Y't;t ,�v 'x�'r �!•':tti•„. ,T��' r/.H� r{;1.. � r'••`� /a I: ,'..k.: .ri'•�t , •r^ ," # ';s , ( 4 1;` t. '<. \ Az.t Fi ,,�,.t �L F�;.�, l +l .,. 1i�' � ,..,,,� i.:+; �'tr..�, il} �;a t` t, ..` .�...:L. ,�,,.-.tj �....:;; •t. ,r.l;, �y , n•t' � r •'t ..�> E"(t",..;�-.LZ.. � ''��L� t'� .-�,r' t• , ��; ; �'� � {Y��) r •ti' „r, 3i. .>< ,1r,r.:a•'t jija. 1 '! 't Y , •'.Iu, !• � �Lt i, 1 FR, ; • r`�.yert .r,!" < � yr ' �,' 4 I 4 "+�SL ' � i t�• . /.r...f't r:r,;_t.+:';.. r ,f i1- C.: •.j_,'.:'�tr k:s•'J.i. -,C,,.(iia.?�'�4� �'Xj L��t k 1 1 �}} {,r�t, i t lv 3 . 1� 4J � }}"� i •',� S r ti j"'�T � �{�t3 7 i � � :.�t „tL-1 AryyA,, y,iit U t•e;}, 'L' =,�r •9J 1;�';. ,Y, ,Sp jS r•jrr''� 'r ,!'.-, .� i ,t ✓ jr� N,.�`,'t, ��i,,._ '"�L� ti"t� t L .!'i''„�;r ,:7! '.� '�1. '•�A1�i,. i t1.�4 t 'T } J� t(r; 1, �rt2 ,�j. T�s�•;Z2 .r �r•,t„{, 'y � , , :,r � f.aTy �; t, Ir, r tF rlftt )rk?kl t h{ ,!..�i'• r`1 A ,9 •Y, i t_!,, i.t f' ,. , �. A .1: s.l, xr -•.,_ .I 1 ..,..r �( 'f a � 14 t t(4) �r3• ff,r 1.�'`�![y° 1. •F�':r�, t r ; r ?, , :i.. ( ,i' +.a `� �.1 's .:ice.. #r' ,, , y1r-S S:�� '( E,, ,� 1 , J)k {.f.. ! yy,..•j.,.(( •�! r'� %j k I�.• i �.'^� a Ztt � :.r� Y t It tim'{•+(�t•. if - ,1� r t'< -f f'�r F N v'lr'.•7,;Y l�.a tr � ,t, yw_ �i{..,.� ...s.t;,. ••.. _,• .. �r.t.•tI.! } tt r_.. to .,� }t''�� .';'<.c �s,�Y.' ••:rra 1r t;f..�rgr.{, l I..- ) •�;�., L f �-{Jn _ a; '�! •:1.- .11 ..� ��, i�i,1^t�`' .�J•�� .n„ I a�';;�y�;,�,. '\�W�;•�x r ,1' , r tr .. /.t .c r'�irYt r T ♦ r^' 1 + r ,,s' r' '-t •mot ;{'r -{. L, 1 :? ri y,!}: •#• �.,;. ,�lyi�r ^</ vt �'ew ` t a t-, •rtf.,,�t� �'r :�tt '4 ;-��!�.J `s�rJ' ',�, r.,r.'i t....f. yy.�:�r. :. ii Sat�T.l..•;. , �.:..` `, :;'. ,�. �,;��. "tt- t {lJJr .!`±.. '/ i'„�'•?+• =�,�� 1- r�•1 r' 7 �r t, irj �,` �. •,F;' �i.�l. ,� +7 , ,.,., 9 �,Mfr � '�� •.{•'�� if ,t�'. !i ,,.. 'i • v'<t.; t, "' 1, ,:,tV.•• t.'r. _u �r-.r t•r{u r� a :+�.J i:t•�,,'�,(� j ':t1� aN � f F ._?: r.#:•yam ,'-„7►• � rt, r_.r, i{ +�1 ,i .f.• a. !- - 1 t � i � i '� t rj .f:'rna A rP # - "•S �� .r ,' r L✓ �. r"S >: ?j'} " tiM C'' r.>C ..+; < ,1LSx��:• uh rr 1 t.�. , 'i l• ;L r. f t ' 1. • I 11 .+.• i3 .T Y r �, r 'i, + r r' 1 r ri Cr't- 1 r. 5.,� f.tery� .r:• •`f+ f,f t •i 3`�„ ,w. rY f•,stir, •.fli;y. 1 •r X 't lA�y:`- 1rf ,_r f!r ). "u.T•'l:^ ., (rr / .vSK! r,;.l{ �a r }.•+y 1,:5\tl e \ 1 t�IY,J ', iC/ ,r,,, yi4r i t 11 t'rt+,• ,fl tr '}' I ,! �J1r. `` y �`" ,1.i� T •:� ! :r X�Y�^. [ ..' -,• 1+ a:, f a r5, t .y��' r ri ��. ,fr �r. 'ii•" A1;" , 'sw•.^)l "+N, ♦. rr.. �d XI"3,� •rF , •+ .ca ., jY= Fr; ti r. `\ ! !f� 5i ^9 t ^,•.M ,t-.:,�.i ,...,_; t• lot ,�'.�. r. 1.. r � lt,t# ..•:-'= •..._ {,:•: �:,'ti}.' �•' 1 'X 1 �,Jt F r.. � i''' �,tr^.fir r.:�t � ¢•:a .,. ✓,.' �E 4, �i,•y;-G .4 1,,l!�a f �,yy i.ki,Y ,°•,-.tf:,�• '. r :. ,. s,,!`. . >.,: , r! #., - t� _ _{q - x• t rl'1`; r -�t T• S,�},�f' �1 i :fir 1°1 �f'r Y1F Lr,L;� '�'� •i � ,1II .i.'t :1, x,SY ,� 1•' �" ,..: ^'t r.. .:! �. :1 '1 �, 1�.?., .. ''i. :i .1- ,- ff. ,x "! �.4 f:' f. •+.1: f>! ,.r1.:r�,. � ',r' t,' i '�-'v ' l.i: '� 1 `' .ti� 1•1+ �,i•lr�t l,, .,� /. '.a�. A, '�,t r, �i; •x, •' l a 'r: t ,1' .r ! t, .;�. .t; 'li .�� •,y, ,�.,�$,,,t ,4'• '►�C ,i,c, �., :,,.1 •�} 1-t:•i.� ,. ..•.. `^ !i ,: r• L _ ,t,� .. ' ;, ra. •C �' .. ,.'1: ;,�•.y:; i'y'/� +rt��4 'K�Ws��t ,1 : ,'�iaii�r: tt',:i�t.>4rfi. 1lPLY i.', �,.;.� r1'.- 7 Z,y, , , - .. ,," t.•v .,., ...., ..id`•W-W r �t,,•:c _. ....:•'•+...ati.♦ :- .;.,, ' �+ :� '�" -.: � ,�'i ,.er•%.,. t (r_.,,:�SY,;' ��F;-r:' i , t , ' .SP• ;1(.; Z .,.4,r 's, i,i 1. All ��• '`i) - dl.�i••T }.�:�-��f Y •i�'tt �+ -.i tr --+.. .,ce. ;., �.. ,•,. ,,. +1. ( `.4'.. t - �` 1c is y ? }'1. c '.r'`„'1. '•1-•t ......iO r f a_ .', '> �,•:,, ,t ;,.,+ ;. ,. 11 y}.. _ t, _t l; -(r.it'. {{ �I ..y f+:.. ; ,' ., �,,.. t -. •;• .rt '-.T�•,' :I ( �„ Si' i .� J." {' 'fk -1l;=' �r tS.. L,; '':-,y��: •"},,.- '"� r %.., .,• s ': r '.'L1 .K,.1X': rG,' t ty 1r tr rt�. 1" •!�!, � - t ��•.�::... .. {.., ., •,y!t '_,"1 . ::,, 1,.j a},. trl t1 '�' Y} �': Lh.tt tix.��"' iy,. :?'t'.I•, ��.,. ..,.,•t., ,f, r - - ,' /: r iY 4, th<,. i. ' , y , r,.`r1_� ,..� iy r•z} t'.}I'.Jf .i`':`-! „'.. .`1t2 ,:' 11, '..., _ ,, ", 1 'ft -_i� %t �j lei;`. ..,,..,.ti t^ Ala,"!:3''r .:(' -.....• ( :• r -o'- 'ttt '., ' _ � - i:. - �'c y.� �T'• 1 /y �i t r� } .•.,.., ,r.1s rk•..1�� '+:;r.?ft• '! -.. .. .d•. .T} },. ': Y.' •� 4. r,. .t� - - : f ,r -.'L•.. •,r 'l �}'.t, , s ., ,.,, ,�.«� � . - ,t., Nr3 tJ, .-• r f: t - i{. i! -, 'L' ti, rid a•!„ .>..rr r r(,. s ', �j�, :c:L-:.,a..s{ - .. 'r'�r ,:. ,t.,,. ., t. ,.. �,. .'.. r :t y .t. i -, 1, {}; .Y r.,T �;•h,� /�e� ,. A•r ":r ;u. '.. 't. .•` ',, •". .. .•'!. . ,.i 1 y w�, rl - rX. lt .Y ;,` yL y - ' 'yl �•I xL: :r, "-!1': ,.. x ';, - '" ,. .,. ) � ,'} /� ., Ft)} r j• t Jt � ;i'.yy 'L:.�•,� F ? ) , ,.. ,..x: a ;• ,r, 1 h •`' ,•iT ti. Oil VV, ,; a�}.a;,,f, t tl ;� ,t ,� .:� ♦ ,i. !n !f "', ,S .'�f, (,,."_'(:2 - ��7 r•,, . ti5t '„� _� :r ,. .. _-�,. " ` .� •',• J,.. tr r,' :�, .rlr. Yl - �:e iL .t. ,l'T,gl. ,;..:.. 1 �• ,t:�.. .11`} ,. `, 'I . . t•.r. ,: .�.( '1 T' J •t'' ti ,, , rY�- .�j',!,. .+iz, ;^1 � ,:.�, t ,r-. •. '. r r `t t'`.•t r4 ' '` a• _- t� t .t� 1n. :{�' -,#'. .3� ,, . = 1 t,`' . •. -- ; . ,. ire, , , , .• �.� �� t7 ,u � ', t. ;} 1 {;, at ��i �. 4�pi:� •. ,,•. .. �t., r'y..:,- .:� .•,' : l fit' •.• ,t�� - t .,��y r `t-P,a,�+j, .. ..,:i. '::',ll ,.....-,. -: ,, ,.' - y ti 't 4 11ti• � ,,,,-` ,a. .aK,.�.. 1 t, r '�.,... ..a...,. tr J•;,. ,, ... , ,' , .- ... -, ..:r'•�} ! 1. r.. .'y `'`4:' � ,� r, 1 �;J. .rl{F! !•:! ...,. ,' .rat,: ..,'•.t., �,�' „- �.>;.. .,'.� � ' ,,(, 't.. �f 1 ( - r jj •n .T,.a �r :•:� t i ,s , • y " t= ;j.. 'h�:1'yt �! ;, ;,I Jtr _iF t - .t�, 'i, =•„+ ''+.�rLr . .. ,'i�_ f+.`,is•:..si ,MS,,y..: .., ..�.n.•...ts._L3.L►t,S.....x r... ,� •� r yy t •.. j(ry '• f' l�Sa•? t+. �ti♦°r t i `,�`•., +t ,� Zit„��fi l��i t t C a �' , .�rt r - `. 1T ,=.• At :` ,t9 �3,y�1•'-1 or transported any Hazardous Makerials to or £rom ( Prope•.ty, ' 4 From the date of thin ac�recanent, at shall not cause or perms the presence, use, t ' Property. /SELLER stora a or disposzl of any generation, release discharge, 9 ' Hazardous materials on, under, in or about or tie trGr, s»ortation `„ { ; tL The term ' ,t ice,:,,..` ` `L, of any Y.azurdous Material: to or Erom, the Property . }{ t 3 , "Hazardous Material" shall mean any substance, material, or waste which is or becomes regulated by any local governmental authority, X►a }� y t.+ lYj} ., j7 i tine State of California, or the Uuited States Government, �. .' t including, but not limited to, any material or substance which is y , �,` 'GFic` `4 i defined a$ a "hazardods waste," "extremely hazardous war-tell or r if r `r � t; r ; •,,, ` ; "r'eetricted hazardous waste" under Sections ?.5115; 251`J.7 or t_ � ,i� rtt �; 1, , t 1:•t rt w. n t tt� t 251a2.7 , or listed pursuant to Section 2519U of the California Health and Safety Code, Division 20, Chapter 6 .5 (HPzaXdouE' Waoee },w r ' r', ,l11h3'3 FJatj,T�,,s>v�. i Control Law) , (ii ) defined as a "hazardous substance" under riA7S�Jl:,t+�� Section 25316 0£ the California Etcalth and Safet, ► Cods, Division it)rtal�r rek.tl/}' r try t'`l�r r� t ..'t t 30, Chapter 6.8 (Carpenwer-Presley-Tanner Hazardous Substance 1 S t i l4 t+• Account Act) , defined as a "hazardous material," "hazardous tiE I; . ►t5y :°`r'��:; substance" or "hazardous waste" under SecLfon 25501 of the :Y 'Lt1,717,i7 vl Yt ji ='• f California Health and Safety Code, Division 20, Chapter 6 .95 ;ti t�iy�r wl�'�4'f1� i f � ''>�� ' i ,�J• (Hazardous Materials Release Response Plans and In ( iv) defined as a "hazardous substance" under Section 25281 of the Y ,; '�'� y1;�Yt�1" , California Health and SafetyCode, Division 20, Chapter 6 .7t etroleum, r ,J!}}'tR•' ,`'t': ' , (Underground 'Storage of Hazardous Substances) , (v) P t; vi) asbestos, (vii ) polychlorinated byphenyls, (viii ) listed under Article 9 or defined a's "hazardous" or "extremely hazardous" pursuant to Article 11 of Title 22 of the California ,z 'r 'tt s,1i ,t.• Administrative Cade, Division 4, Chapter 201 (ix) designated as a >��• �` t � ; . "hazardous substance" pursuant to Section 311 of the Clean Water , t {' ` AI �r•\l<• / :'. .,� 1 1' i , •A; , ` 1 t ,..!•i.1 C ^ ,j'� �} a}, r f 7•^ M1� ^j,. ! !` ' r ' r ^ ,� ,1:,+✓S�,t "yr•��l1rt7,cf1t.1� .}�,7 c ''t�:t 7.+` r*1.�,` c: :i, t , +` r,t_f,i+t•", rtt sit,"�sfj ;` 1j,il�Js�f1: , �f.�f '.,��i '",.�''1`•M' '�J,,.�:, 1t i<:�'sr- ( ..> F ,.:��.Ar }1,. ...,.. !, ;.,.t say,,t t' ,i ru_. .fl .,t,�+>� �•,:t t� •- +�a t'�7,�.,.�1•J' �i[�c.�i, ri ,�,. � �tltrT,,,��; SZ' . + , f{ f(r '.T } 4�;.h.�' ;f J,1 «.t t�+C '�c � f frt` t �3(J'.+t t �t'J{�.t-Y{ tf kf {; �Fj`IC�Yt..e,�r J+iy.�(,�yi".1. t '•�'l x :. ..«F t t �,'}II t .+.:,, n..t`-4, t r c.•t t, i s 11� ✓,.� 1�y. , `;i. /. 'Y�t f V 4^� { t l,-�,fa3,,1 ,.�,t i•'�j� �r ' .r�tjr};r( ( r�..�'i .;1. 1?={ }��r-''►j2 � ) JF'- :'r I<at�4f., ,t.t , .try r7;;:��r4 ''l•J'q 1....{t ,• y`` t�3lt.:.y. FF ).y.: •y+ !,�' .a :':� 1 :y,• � � '1.+. e"'�t ,, �y� .S':; yr l�v., •r eiSi. i'> t 1;�,.�r 1,' - `1 � ii, +}) \„ :t tis r1„ 1. r,. -• e .r� �r, tt, y •y��i 'S , k ,;V�,_t��, ;><7y t1:�S'u'It k�Ti � s �, } 1 t` �.� 11 1%�f ,F• ..� t.'i• , ;t •t � �t. r 4. ) '�. l d�:,l�f'+ �+� •+•+ - 1 +' � r ! � y�,. x. tir � >,, 77 y ,'t• r. r t. J4 ,1 t!.�'�,r veY 7 T, ..:, , tt } i . tZ. f .��, :.,;«.; r. �'�-��1�`J +,,�.:.� r .,,..;t,,. �} r,,i.. y" !'- t•t.,'.� r7 .t. ,.A�!ii 3t1> j (1'.t _ t 1irJ•'y,�t�i•,.::.•,�tt 1'+,�!i?`�it'r��, '.ST"'.'� �•-ir I �IiTlt1. i•, i• S�'N'RT'{in,v3� � r..ff��fjt 1"l11,1 ` •4,` r�, 1..,��! 1.- �,y.1 li s�1� r �;��y� } f 7ln t :�`ti,.,gt.. 'c{ �r,r4u yY:i t... ' ',�� t•`t+Yr tr �•,, rtv tit'�t��, t r. �I r�,� �'>t r X a�i 1��4, 11 rj� 4a1 r.:,Js,t '�.>•.;; 1 /1�t,•it�,�d Y f. '�;6'�'!`1 Y �■n� }r ,.S.t+{N��;; y ,r r �rS. 'r'1t�Li 1� � •y;�x ri t;. i' c�' �-�{, t'"%1, IC�.."`� '7Lp w, J•-�'� ef��.t'L .��.. ry,f"t'•(tS{f1:r,'� r� ,•t .fir i ,,t:• i' .,; � ". �lf•+yrrl' 1 ,.,r t ••� ,, ,`,�,{ , ,_la+, i:.�� r'..h., �t•r t �#�r '.} t t,'i:'S ,, 'it '{Y° e r.,ti y 4�1 '�}t'•a,r V ,{�� C.1 ..r't .:J �' ',.} 1t t .,, -,.l�•, 1 ,a t''r•,�!'It '4h..'::S {r�_mil, y�y��r tt',y ry r..`f ••33t:,•(yt'r,f',i��,J•r'nttrSkis Y7.i,:i:!tS rt '1(i ':.-: .,'t. 1 / � 4,t'I:: ' {�rY3'. l 'tZx '�-'�':l �F�' r. lf'+�d �, '.' t . t=, :.ttTl(t{t'1t, f,F,,( ,.r 4tt,l.. ,t� ; .,..�.. •i .5:4,5,,. •, , , !L�!'.,• r.,.�^1 R�1.�;.:1 +.,T :•.l '" !•"jf -�1 !•,i /• „ ' t•' ; `s�}r" 3 i}'`r�,� ,, j�'.•feh f�lr1i!��t,t _'� 3 'afi+ }f _ .�.J' �r,•t'.•• t I�t� 1x}f !� ° ! rJ � �J rL,,. 7 t, i /S(( Z i" I , -!,•�. - �.ft r - !J s .� It h t�..,� 1 ` ..,, a ::tj-n2 r '.`a� .-N w''••"Y L•1'ii. h�, i t iwt{t�{•et: '•. t f3Yf �.T;'rt�< :S�i t .s ,. ti ;, t ,:• �t ti_'t , ,t .11, �/; Si„,•1_;, _.•fir r ?.•' t,;.':-: f,y � 1 _ •,•f rL �rlYil)r, •��r.(�'tCJ�.y r,. r � .�':Ii T` �� i. , '^}s, ` t i,`, tr r•f+ i y t..,i '�t^J�I, V(:1 3'' ,tt'1.' :i �"rj',•sS �l�'� '' �r•' t J+,1 t4 't. �••f tt'tn , 4 • t. .,.,.. 1� ) •t 1 ^,_ ,,, ' �:f •,t f4.;T..,t F tY{7,y l,I ..yrI t,' �{ f Jt •1 (1,.. 1 'r ''f'�;'-�.lh..i.,:l '.t4 ,[:rVt1r�{�, ,:dS�,�1 i. f r j t >.`,. ' rl .�f~ r , '(t, .�,... r T ,ii� Il;y se Yt„ , i. .•�;;,i 1 ..r''1 t / �,,:• , � J:i ,},; f is } l.• 1 > a :l �,i�'r•i, T7 r.•��V ^•Jl�y', y�,;'J��k�h.,1:�ti ,YS,,}� ` , V' r cat � r, �\ ,r `.f. T. v , ,t;• r � t{ _ - t. .•r; c. ,Ct, r. , '�.i(, °�r.t. -1.�{'i.1 j tj •i r .r t+, � 1, ri \h. •f' :� `lfi. f, r.-7 1/ w ;�� , � ''.,y l,. t ,�,ft ::•, (.J '.t, �':' -3 i _ I, _ t f ,•� - .r;,. r} 1 •.�st �i� 7 �l� i. ''T r :' 1) _ ., 1 1 ,'l ,�I, t , + i yy .y fj, .�'', "f; .r 'y.,. '! '� .1 •fit'. (*• ,j+fir- tine.',_: 'r '�r-iyj:. S'z.Y �: :1: i. - (: f t•',t. It1 t}.+` �. .L 1 ;: ,- •t tit.' 4 f ^. :xr ;)Y+� ( +:'y,Xyy• .' yr n fl. i ire S} (1 (1. '+ .'t-�1 +' ^i ,� pp J J - ..,.• .,` I . �d:• # '_- .,.>r _ .. �' ;t� � , n.lr +♦.fir •:{'1 ��'' �a -!I«;.., rs � ` _ r fry •��.�. r7•'-:�� Slf'r. .' S+`r.-Y4• +:r y -$rw' .`, rl il.i. �•+ �`.�- - ., ,a. ` 'Y _ _ - 'Yr.t ,.�` 1}1}4t:LAt' .,' ",R. �.,�± i �e'M trJ♦•.1'•. '... _ ,iJ�l.... :'j "•l v ♦. 4 .r,'1? 1l � ' l:. r=•3 .., K ♦J\ ,Y (�..' ^ 7. r ,a s.. �, 4} ...�._.- ,-,�, ,..�•1 r. -.-, _ �(. r I!, 'f• f _�jilk,,J fl• :. f�Y ♦.ar ,J �)h i)) - ',:�. '1♦'..,�,.y .r .. . ,J ..._... r• 1,I. . 04 ort- •rr r ,'•�1, It, f'w^i�.'',,.J•! Al to Y. of j. f l 1 ^ .. 1 .,1A�'1 t',..,,_.+. ,;, .r.,. ,.. ..srY .` •` - , ,,,_ r}t ��1 ram .;�- ("ir) ,. �% 1• •' , -' t:- , , ( h 7Y x: �• as, •fr :Y' t ., +.- -': ''.. '. :' -,L r.. :;ltl'' _ : ('• .f� i � ,"i "r7 :��_ r '.`t+.,T �..,.....•., -,� Y}.�:1�4? :.:4�. .y;,%w ,... ..'_- .'i) J+ _ ,i Yr� _ t• v J1 �♦ ,lii• ,'YF ,, • av � , r �., . :.. ,. ,, fir' .. .�� -, ! 7.•r :, . � ., 1 - .. ;- 1 •. . _ •-�' �� t,�,. •„� fl J if � r.1i � ),! .\,:.', ,,.r,i:;,. >,��h+ ' •a•. .: ..,� ,,,. 1, 4 ••_ ( -. . r '1� i.r/ rr ;.,� i.>.11'r f y • r f � .� 7r "ram �. ... ;J'\ t�. �'• KG`• , (� �J,�ti i ,:M. -. t '.'� ��i Y 't� /.'. .r I` r " ,� '1 la• ., ✓ - ,it sl. '.Y :1Y ,1 r i(�• "NS, y;l..-�•��': lr'S'''�, { rt.• ••,_ .,,',} :,••jt , a�,/,f ... ..J..l.�rl. 1lrl yl •t `t '',' 'r. 7.r' , 1 ,� J- : •'•1 e. ..,.t yi. r'•' .: ,...• ,�.it-. .. .. . �f .r. ;I !, 1, 1•,, r. 'lV. aI r r�;py �} �r fl J "f ./r -ly- ::A'.r � t♦d, -.(�: " -�. ..,..,. .. " .•`' _ ,. . ;`lry, ''+' IJ (lt.r v.� vtt 'Xr r+•. -, y:; m',��'Sr� ,;tt � •Y,.... , , - �,( _ , � ,{t �� .!' ,�. T It y �,'' �1J�� r Y �.i]:.' r .•:t(.�r ;{1r,t f ''. i.;,_' i•�,�,•';�.lr ;) ',,i R i„f• 1f ',t. ,. r s. ? - ,.. , r4-,, JI�..�a. +l�•r+•f ,t� �s.. .("'--...�•1 . •1[ •� ,l r, l-,. . •,. ,.lis # .- r a,,.. ,,. 1.;� d•: +=„.• -t •�. t;,.= 'Z'Niry('Ir D'7SSMhtM.;,t�rr r�+ Yt� t. fj '(, C ; •r .4r� ';ia7•!.•�. ;'...{_'`.i. .Cr.A.,.�.., -...n4•:,•:..r:rt.i:a��:h+,'..:.:.�..3'3 er,v:..' �. ,� :•rl y}! •. ..'+tS.f ��,, �yF'. fi �` tJn�K�',a�11: �It '�i tr� 1 •. 1 i,71 tj �' ♦ 41 J Q.t`f. Act / (33 U.S `C. 51317). (x) defined as a "hazardous Waster ursuarth to Section 1004 of the `,• Resource Conservation and Recovery 11 ' 'Sr V0. r Jw Act, 42 U.6 .C. S6901 et seq. (42 U.S .C. S6903 ) , or (xi ) defined asr IJ i'11ti YK�tsv },' a °hazardous substance" pursuant to Section 101 of the ,na`•,ri/+r'N ' rt•r 7 : T� 1 l � r„l� r •s! �s"">'a. a s '-'i'1',1 Comprehensive Environmental Response, Compensation, and Liebility X t Jj ��r rt•-�'' t"�'. , } IJr i 1 j Act, 42 . U,S.C. 56901 et sue. (42 U.S.C. S9601) . ritf` •1 ;tt� ,.[x h �.�j ' lr�j -i rl�Sr31{ ��Y''. • r�j i C,-+J� t•.' Q`I �•AmrLl � w n L 1 +,t. ,\ J 1•. �r t 7.1{ l" ?G�' y i. r �. t a !' r ' �•� ��t \r t i� tJl�?�StiI�W� nrEfr ` � t gove mental regulations including, Without limitatto , all tl ; Y ,• -o•�; ;�' PP Gabl federal, state and local laws pertain g to air and is ip � N ,•ri . , , ;, ... ,� # + r; �1y�;y�•.,,{, �,t,:��s ;�1� water t• 9ua'=ity, azardous waste, waste dispos and other ^ x .,'c':,► `�s t4+`:' environmental matte / inclariin but �t`.r,A�,�::; r, �f, , „•,,r 9• no limited to, theClean r water, Clean Air, Pedera Water Rol tio•� Control, Solid Waste - f �:, u��J,_T�+ • �:l.,;rY= r ::,. Disposal, Resource Conservat ecovery and Comprehensive r7 e�•l�ti�f rr.i�fi"r�o�� ,i�L��l rl��:'.� ensve r y' ,4"s� ' g{ �. Er,vi ronmental Response Com nsaki o and Liability Actc, and the rl � "�♦ California . nv +,onment Quality Act:, a the rules regulations " t and ordinances of a City 9 Bea of Huntington•;��,.}�-` , , rr;,_ t�i, the California • Yiy , ! �L�,,.4• Departtaent of ealth Serv,ces, the Regional Water uality Control r, hr r c_ t f . ' (,�� •�f��'. Board t State Water, Resources Control Board, the En ronmental Prot 'ion Agency and all applicable federal, state and loc 'r'.' r''t t T'�e�`•f�r�7t'k'J:�. and bUEeakiS. .,4 em till! Ary \ r� proceeding, g/ s, cost, damage, liability] deficie , fine, rr ~ r , penalty, punitive dams„ expense ingot, wit o tt 1 r•� '•f� y`'t limitation attorneys, f •: > � n , Y , r test u from, i.riaing l it of, or jkv (rl I• 'rr i. sty �µ based upon a presence, release, use, gen on, discharge, B-t"'•ofage or disposal of any Hazardous Ma e* rta:s on, under, in > (' E*� ' ?r. 7`r r � �r}it'J(i.? ,r�SwM.��R li '! ' t ♦. r ' ♦r �h�y� i iJ�t`.�.:��/+r[��l ' f � •I..l.''i 5 !� ��.:t XJ �. , r '. + �::.t � �' � .`.) t i,r.• :! r' - r its rY �. , . ��r �.: !`r' F '.Jr 1 °,f1,;1t,r1:. ! i rT ',i t.Y ��,', (" { u,:Y i s , .,J♦ , ��'(�Yr { , r5'C . + 9f w , F, v� T•. � Y r '. r ,( y e , !; •i J jr^ 'li f r �; {! . ,r t(i i ! .rr f 4 LI �r`✓} t 11 .j r '-rt ii, "' / l t �-t 7, '♦ , '1� '1 , )• ,r rY ,I� ,! r ( + � r�J!t' t ;•S qi,7•�r,f r t.; 1� 5'^ ♦r't i.r t Jr, '�" , 001, 7 :1 il' !rr�`�t,i } �,.il:i t <�i.'� i'��i,'l�rl r ''� •�: �(•,lj�� , �,}i t:; ,1s1 ,:-. �'j,y` r�t,a's� r i �,jTjt t{{1�'�,�'i A;fyrr��rt (.i, .�yi'M•� Y{`y r•.i ) r` V /t k. 4( ,}:; t /+�:•s(.# ] J ' + t�+ Yr( 7.rt � '`�,Y! +` �<f r ,:+s r tnr ;t .1} ,' r µ��,,f t�',{.� r �� • �/l `r i j 1,•�� y. } s( yF f: .1 �. '!Jf J+4�,^Y',1 s t.' a Jt'.,• �' �` 11,X�-,�. r�U,'f wLt tii }trs�fl' \r �ti•,�rrs,,'L li.,a ♦+ ti ',,� + r ti�..'a '3'}i Y, '�'.a yt+l� f-.,1+.+.`a t r.. f,� . [ Is r 1 Y 1• J Y 1r 1R, l `•'�..J�f tl !r L f'S y '`t . t fr +.1� r•t t iil. �Y + Y. ;±rt�it T U31..,• tiff •.r U 1: t4•i rr'� ] i'' Cr r.r Y' ',r 4, t :t s � ♦ �',E II j t . !t Y. ♦ � r (r 1 s Y, 1 fit 1 , v �,lr.�} ��} ti Iti'r`' 1 31 Y ��F:c � r•�y� .\l+r 4• �,,; 1 '/t;'�� 'IJ 'r •` - a ,11;1y• ! s 31 } yt "♦. .1� r�•! � r i yY . •t` ' ��l�1JfGr.f\+• t'yf } `i�rafY 1�gf:ti. ��>.•'•, � 1 � i�,+S,L+ 4Y, •f; � {I''rt tl"'`j �..� rA► t jM;'",+ �./"',;��'a�1.b.'.t` ' t Y.IL'' *t ;i•�.!'n ,f_ it +.- y r f rt , r t. �( n . (� , ♦ l , 'i ti*. f �r lam��t' M,�Ci .,t, r ti��l•y � i fyyt8q11 ii•�,� f •ip r ''.�.i[ +1 r ♦ �Y r * ,�, �F!•' 4 )/:,-tii '�j{t�y' r r t.f t, Jj. �F't..l}#��';. �', f�t^yR{� .f\fk f'�+,Frr t rvy;• r A� r!r 1 t,{h , f '� Y' sir/ # 4 t' ;'+} r7 ri�,+(•�:� , `'r F•'• f'!:n *Y :-a t{ y. L 7r � T• f• r a t j1 lY j. + . Fr it ti Lit' ►, Yr l v • �Yr _ :: 1•`�, ram.,• 1 .r., : ': tom. +fit t 3� rt � r '��. r•} s r , }'+•lY/� as�•aY�S 41'r}.'Yr .'•-f.Yt+ 1�,Y1 r L� _ 1 11 r.t � J'a.'r', t � ; �� C{�`.,`a� �r��•.jav �tti tYzt�'-.f ,. .� F>f' 't �.• Y{ y'j' . { •-r.#+,,,,, { µ ! i �I.. j',�.,, r 1 +1�; 'r rY -t I� , ly Tr y •:l tlt Yi 7•,aj,tw r." Y ,i. ,,�j��••''tiA� '(,: r�r x J' � 117 Ir,: 1 '(i+ ('r %�! r r �.'�.1 .�Y r �1. f �,``•j,`ll�r: l.,•.X;,-r�t'.� Y('�S ti•` ' •, 1 j.Jl-' it '•R'}t t,A�i itr j ' "�'♦vd;.".I.y ,H,Yt '..i.l�': '.1 1 '1;#'.1 :.n. 5 Ir' •f ��::-., - r; .Y�r• t-,R +;1'.. ,..,.l,r'i j::X a!�" t ` \ .. A�4, . # •�' tj ..Y J/Sl }' \,• t + I - ...•♦ li l:- , J >/J ; `r(S T }t t, t 1 r .tin'. -.^} t.t�+. : ,�11f"t•'%�s �arrt,r f,. `t':, 1 1 :4 ` � n ,11• 'J�, y,.:r.+�:t. ' ' s u , 1 I ' ' i! � � , V;,. tir 4),.�t I� - f k�,..►rd !.�.1 f•4f Ir a�-•1`Tr��;,t'af:IJti�t>�f (1.,;/ iJ !��,� .,f,, + , I, 1, �r t ii. ,J SI ',Y .T ',Y f -A} a1 iLF. T H .!y`-y i. � '`, tt , ..�• ... .,� . ♦ ! :i J' +.. '1�Y •'\ •r. 1 -, -'/Y!\�1 t-max''�.��'.� -'7 1 + � :~It•'Sl +yc�� ,� , 4 1 t>,r'� ',' •r:�t, r rl - -.(ti1 '.l '" Jiat+ ri,,jjf') `'l.,�l, �:;, _ ;�;iS ,>,. ;� w;', `� :r._• ''. r1C•' (, t;:ir - rr ,.1 ., , ,: 1 iti '� � 'vti �: i.){rR-• t' C ! i• (,1t',+{ ,:.:. ,.:"+ ' �,•'.'; .:t.:';^l 'I"di . , :. ii. ,-:.. s •. �. n•', .- ��{ :1:' 't. r;' j. =4 't ,i •.:{." ;, f► ir.. ..�..• ..........�, 't�.•:'r x_',�J•a-:I,(�:,.: t •' ,! ., Jr, •6 1 r. `ia•. a ♦ w �a r i:` r It r 1,.. ! .. `' ".f! :/J .1 , , - .11 I 1� .r• .rK A,•,t L , !,G .18{.t nl" ` S' 1 ''it 1,t ' y'' j >✓ r 7r•'F� '�°,f;YYI.. ��!, t. ,1 ', ,(� :, ;t},1 t �.., , it r::`( ` .'�.. r �:'':. :'.:. rii' i.� .a•a'r�.:.' 1. --. .,: rV!.{ ;.: r _'.t ,`., .,. fIr ,.-1`aj., �uS.•,,. ffa .r.,.;, Et-. b'.. ' '..s ;..�'`:'.; F �lt'P r : 't t�' �` J,— r ,� 'w �r '.k i.a �, -.�}'�rt� 't t5•1. !kl t 4 Al ;r `Y '.i5:71• t°;' ZII '. _J., 1 •i` ! J,�tr fi - r , � ;:�i {" ,� - �' f.. ;t ::-•4(.-.,,, ,.< r. l .,y• ,,,, 1. , ,�� t-', 1! � ,!1, , .'> ry"� 'tl f' . �..�. i �` .4 , :, . .�.' ,�' 'i+� I. ,!t• : + :Ivw � _q ;{.j:f .� r :•::�'fr'{S I '! Y "itil•:. 'i -,,x '..:.k 7 'a:. ..-r-. .: ��1`! �) r? _J I. 5lti �. � l'.; :Y•. •, r'7•r ; , l ll "•.. f, '. 1)' <.., :� A- _ •Y ..J •mil`'� '.lf �-.'' f• .'7;k, i..., .r .::.il' ,,... .'. -!i - L} -•i: ,fit... "� ! ♦ �� ! , �i .�y 'S ,! +� Mrt ' z i i , ,;i +i;y,jt•, r ;'f , !' /, 1 a 5, } �!, Ivw 1. ak .�1 �... •'',.-"., 5„ ', ;.,t ,L, ... fl 'i`) 1+� >�� ,"t r ,'�:f rQ a�J',`�, � .•,( r„ 1.a-'. ,- ,r: c',5,,•:, tft? ,' r1 • Y ..�t , S r R r:ft ,,�Jk• ,, alit-'•�',h'Zr!"'!►''' - ,,, .) .. : �f '!• , ,- , •r h., ) �' ':' / � v,G. fl: '-»i ` a .. �:. +.,•;;,.'• •�a.•: 7 ..-'• y i .,: ., t, 1, , ,. J ;!= gy, ' }'t ,r. ,.. r` � fir.... . . ;, - . (y. ,j" ,_ ., 'a' '1:.. '5 •� 'f!,rl� .Zr► (� t1,,1.. t...>=:}, .�F". '.i 44 ,•.-_ .,. . .. ,-{ .• [. ,\.• 1� •7. ,� ! �� r- p`.�'N tr �'• -f. ., "'-.F• 1 'a.'... .i , �. c:w r...r.,�� •1� Jn. w;•,: i K .T 'fit! /M' _ ! 'tJ�•� i ^!, 9......• a. :.w'.t. ;��...:..i..:.....:..:'S.`llsi �. i..l� L..u.l. �s -c.. t ' ll. i4 jF'�M'r ti J a 1 r � 4 t y �� lr;t. , . , ' .'• l r �,�,) 2t ��J+• ': t fir.. , Zi r r 11 rrt f J �, ,�,� .�i ►� �,, shout, or the transportation of any such materials to or from, t r f • t` cJ ' •at i y Prcp�%Y. , the violation, or alleged violation, of a� u ment orstatu ,finance, order, rule , regulation, permit, j 11. s license relatin to the use, generation, release, scharge, -A Y` .�r4`►d storage, disposal or ransportation of Haxar s Materials on, c - lt' fir- .t:. r J il'k, '1 A?J Ic J �, '',i r wr••;Lti n,yJlfrrpi' r 0, under, in or about, to or tom, the Pro rty .. This indemnity ,� �' (�f ,a ; .'.:, _^k# `�,•' r, ,' shall include, without limitat n, ny damage, liability, fine, it ' °? 1 • , !, ��; ,.� , tr { 1'k�� i�� 'r'1 I i a�enalty, punitive damage,` cos or a ense arising from or out of any claim, actiour suit proceeding fo ersonal injury y.r ♦t Y.7: i r, i T t.`'3 r �`s`: ( including sickness disease or death) , tangi ' e or int�sngible - ",�• ;NIfr property damn , compensation for lost wages, busi ss income, i I rofiis o other economic: loss, drmage to the natural r ounces or /t f?:F`i ,r t+7 J�1lh •F«t t p rr y7 ti t i .''., ' �� ' �r„r the vi=onmert, nuisance, pollu�ion, e:ontaminatian, leak, s 1, T •� tk fi°; �' 1 �f z . mareFee e f f 4 L• ny �� ...- ;� r5�•� 10 . ATTORNEY'S FEES. In the event of any controversy, claim JS,r ,r 4 i4 It (ia. �� r �. or dispute arising out of or relating to this Agreement or the �'i'�"atlt-i,sr`' ti"t �''S htr•r r i fsC � escrow or any breach of either, the prevall,•ng party shall beVIM k � entitled to attorne;�'s tees . � �t �s�#--'; � 'cat t fi,�)'�••it�` 11 . THREAT OF CONDEMNATION. The parties agree that the + 1 rr` .��ti't► - ,b� ' �t' r�l Property being conveyed is under threat of conlemnation by the BUYER. BUYER agrees to supply SELLER with a letter evidencing its intention to condemn.FN IS �' ;3 �R-(� � �i•'; 12 i NOTICES. Any and all notices or other communications required or permitted by this Contract or by law to be served or, ; E al.•y� or given to either party hereto, BUYER or SELLER, ' by the other r 1 +hti party hereto, or by the Escrow holder shall be in writing and J shall be deemed duly served and given when personally delivered to } any of the parties, BUYER or SELLER, to whom 'it is directed, or it �• ' . . �7.i_f-r'.. l .At{rVM....MA�rrt>•.�}..��•,..M.�I.Y/•M.•r.•�� / T , t;ih 7, e,J t}} ',!+ Iisr a7..J ;� �'r r�l t ( rr � � t� r , 1 i i �. ! 1 i--' , t L� `` {- 1+ ;it a t '{ }t r1 ,r, 1 7 � jj,.��.{• ,Y� J�tA � rJ '"T ' � -# !�' !•�� -'i'a t.A ., �rYf}'!T F:iF' •!.�I. •' Etf2y. ! , a :� f. �`,1 �.3 j«+:,._1r �',lj' •�♦ �i't',r `it�,'j: X• ''r y } ! ' t.• ,;�' j �r 1.'n'(,,':rt.rl�'�►fY•\:lt ,r• �frt:, ,'fir�t :�',�f' I ,,.�, �r .�.0 Y�1 �lvr a, 7�k' �'). =�. „ { 1,>Tyil.,;.�r � i1',- r p,., cL, iJ;/' ,,1 4;�rt' �� 3 - 1 • '�'" .Y ' .7. i t � '.i , ;1J( \J..: , �' j l 1.- .,r�r ,,, �, }.. ,1. 7 1. .pt�, tX�o.i •' .1.-Y , t 1�V YSY-i�,(� '.(>.�• .f•;�ti .�f .:±t�i-tfY i�ri' 1^ ;j' r r Y a ••i.-�,1 f_ ,r ir,r, SS• r ••t'rJ r'�ti `":=IL•i lJ 4i.� tJ:,s,',1.,.{�;''S.R �'?•.. , "• �. • i' 'Y. Y .•r)�.��.1'IA .�lr. J -, J: {' t:e, i. (, r`t.. > ��.. �^, !' _ ► .'� • ti`� ,t .., �r•.I., ry-•r' ,.ls�;iiit�,J '!� 1#.•:r}t}r , 'f�" yt"ilJ.1 G r rr r i•;:_}t r11 '��+ •�� Sax. ��tr.'. �� /.,-+• ' \ , •,•�� r' r• ;,�•�l.: rF c< '/ tj . ) :!': ,J fl �r• i7 �1rt t S >... ',t t!M'f�' }1i:' �:i.• �,(-'i'f : L Al, ��r'• f� Ali i~ ,. .., - f }7` {y+• J POW ,Lt ! r 5 tY i �Li �`i, .(. , 1 3. } ,., 'f.F j,y' •�t t. ; �, •i .. A.. tl.�ti r:l� ,y}nIi3 '(5 `'.<<. r :1.�i�,• 4�,�1•;,r. 't ri �i >.t,t 1,I, r-` �r ire' • r4..rJ ►�.`� , iJ1.`a'.1 rt �l 5.:� +T3�-y.. f/ 1: I 1 1 .. f'•�i�•' {7{lt� ) l: j1 ''�},�lr.t}�i,J "•..)�� , J�.• �,'7w f' J+if Jrii �.v, � �yJ k..1 •}itl,;l f. re .Jltii , L � Ey f�31.; .�,�f�}ry.aJ.:fi i{tJ•, �:;•t�ti.t!•' 1fe'�) •.ill �tl Ji. f �f. t��a4,',. l!^! {}ft� � y. .t..�'1 ``r' 1,.J ��t�+J l,��ii�.. 11s r",�� "r .. "1•��. ..� �...,1X{7T)S' d 'S•13 \ P :. r !1(,'� }. ~'l J �}1 ' .,�� ?:��, ti�..j/ r i7�'+it 4'a�'�T;j3�f'►'1J)77J. r • ' , � � ry y fS It "' {. �)!�' •ii ' : ,i 'J 7,f t r ".r.'f l ''t`�{t !ra �• 1`�.\.i: ti,lr �f it�4y3K��••' .+-'Y 1 � . x t �� u'''. '!>lr(1. St9�, fY C r r it y 1 11 t:,1 1 >I•r } yf J !••� t, ,fr 1 .t 1.Y ri�.fr):J.,�t' Jr.•y ;rL�! � \, r an z t-C�.r! ,) Ya �' �.,� , li tv� t�lj ` ' ,�, f '-i ,�• � r .y�y 1 L�}r't':'a Y,�St1� r V•�:,` 4, 4 \r 1• 1q.. 1 t 'A 1 . , y , l3'.'r�+' t 7 l' 1 ti•\ Y I, 44,F'if^ r i,af � t ,\ ♦ a:• � �� 1 i. '� trJ• J'Yi i f j\c. J � �, ),. 'ra t,►',• • $.►'l'!: .} i t: t 'l ,t r ► r f , .. 1 , !.• c f ,L. ,., St �3!trr 1 • � *� ? .a '� � l�sY t{r a ti}r:{ t4 l-.t� •r / f � r,� ,r :1 i t:!' i. r: 3 a fr i...'. jr `1 i;, � r 1..t'� e. '!I .J , �. .I �, i Y., t.a �.'"i�! .r. t',,,.i .,.�.:j<.:. P(i}.Y .t t.r,{'.+' 1,,-.. �,r,j'+.,}. , .Y!U•} r Ly�y�� f�Yri��'+it`i4•iiYlY 1`I t "a•'l irX rll i,t a �♦ '!.•1 1, r. ,I.,..J.;.,yL,» .1,11 ,4."t. �v� y.��,r{�},}y�yr • , �`7", � IY-f�II�' _ir .J 17�":(�j-f � :l�l.,li�(r�b�� 1�frr-• •l t r � E�Y.';t f':i`t) �•Li'�,' a�Tl' � , ilf�i'.$ jj A';F,r{•-r•"':+ t 3 ""�'�SS�,• •V19 r �I i, 'k!,�r 4 f✓ F. } r►rk t(4�,.%J A,•L �Sj 1 r!t lL�l�rfi' �4^ 7� r, •{ .i, �� •,�y1•.. !i •,(� f f; - Y•` r!t i t: S .,,.,',�7 t, '�, 1 r i ♦� \r ; r ` �1 .�...� y t, f rY' R T �Y V ( • / J ) • f � if7i! f ;•,t•i.t'f 1 ,••Y L�M7?.tT'..�,:5 t7�)'r.--rr,iL�ti.:,�= rJ t� �r t .1 3 j! t _t). � ,J 1,. i �`Y�J Ji'1/,,:r .(I tl tlr, •rt�,f;'�� , r jyf-��'A•� � � (7 y9� �1 n �' - , ! �t i `' � 3'v iN af" IU' �f 9��t `yi' � dJ: �; ��t \,'t'�7--J,��11 � i.,}I•rlr 1.� •(� , i r ) i 't. ♦, ...�t ,i�', >>t /.1�!' f • r7� , rJ :;• Y1 }! . I',I r y. ! �' , }' f tl J fi;, , S� t.a •t�+ 1 r J r it t} Z:r< tr ri S,;fIJ, t! 1{ r'/lhuo:r ( 0 1 r ` :� •\,1. � tl+♦:,9• �;, ..rt� �� :1•i.,t f 7Jj'� I�ii,! -�.,+ •� l,l�t,/\ i' i. i ,t•r: i. 't I, i .I ,. t�)r i..ata '•:, �, +:, 'J in.??�. ,<,�"�("r 1 - .!1. ? i- )) /:.. ,.t = ^! i °.�+,:n! .4, �• �'..'.,,i 1 t - `i i'r i..,'y ,r�'. i � �fl}'�• i.r.: :a.' J Y (l ! 't•', �• , • ,.\.t ,.J.�, Y' a1"'lQ4v t. q 1.,. S'F•, .. r , 1 �rh J'reY�iirl�•}�,it r Rt-: tt i - a n. •l r f. )•'h' i 1 .it I f , ,, ,•.-M, y rr,. ^,.Prt•:; " .•, .: , ..r� J.'; :, ,• is z 1 {; t .f ,} `t t, -i� 'r't '11 I i k; ; �,[at�,• (�'• �': r'.:-,j�.,. =x• , , ,, t,^�.,! y�•,: .. -��• -,- �• .f/ -•:;ICI, ,._.�' rt r '• , , :) Mt-♦ l + { r , . .yay. ,::'-.,, ,.:'1:,-_.r •�., c• :'..:' .:.••!. r1. `,; - [ ..11 _ •, )_ JJ rrA`4i,'�•,,,• r,`+ .;; t ''2.,'`• ,. -:-,s +•. ..,-,c ,i'� '1 t' Ir �r� - C, r�.. . 1: > - - , :.h. f — r• �f _ ..��) ,; vim;, c� }�" •. '` Ji ,• •� .t '[ri Mf `t .., _ .y, ,.` J� i ,i ~y I i 1 ,, t- S js ,: ! r 4, y. {I 1�•�'AA , _ .,. �i _ r a. - r• •'Irll [. •!tit ,+� .�•: ♦+'. r 1 � .,:.1 ry •-. ei -. ,.�1,,,�..; _ I..i, :. )t,., � >SL - 1 ,= 1, — .r' , ';ti, •,rtiJ! J: 01, r J ;Y ' it ,/�'•• �r 1 t r`I,., tl 'v , ,�, r` , ,; •^` •t 911.. .,'t 1::. ', •t. `}r• 1 w r••i.A1.Stii •, ,,, i1 y.: ,�/ `,i ..;� ,.., , .-• , •• .'- -, .. . .,,� �l ct.- ..- r t `s iCt , �1 :,, ��-L ... r /, „ :+ ;>',..r 1:1 y•4.•.' ',.1. .:: !r '' ~} •U, d. '.,. P `A �41+�r r4� • : z•t; t'J ,y -..;4 �,\I t,�, z.. . .,�.!*. ,.r.1 �t• ,r ►..y,� -i i+ t r '{. r' tt!• t ff'.! !, .. .... r,.L?::,:';ri- ._.,;. ♦. ,L.:..., ,,,. .. •, i. ,,';, .i.t ,i. 3' 'i' �' ?i �1 '��t• 7` �,;. rr. .a•." i :i: :,: " ,' .f-'-,. i:'1►�••Tl,.�..`i . :;/ _ .:f +' 1+ t' J.rl` tiZ _ ,� �j1 , .»•I,`s" ...�� I�h,:,-.� +r r?-:'rL! » . r `} - r r=� '.�' � �t A1i ='i �'Y� `T\.., r ,i....t, IrYY�l.larl r..��. �1y��M..•.,- - - — 4� r..ii t.,..a]!( .1. 51,;1j +.•� .» ,•'��' l l.j / (' ± 1 ,a �f.�ry ,!rhr\ ' -�--- i f�[y n_C,("• yy"7� G It, r '� i�1 i'j�! �' • ' '`• 1 . r , , .•'•fie t` ir v ��'.�,'. \ W i {!' •�tkTp , � , � �M �►ut r t, �fl t rt, t ; r L�, tss ! \"�/r am Z, Mkt♦ 4 :i ��rt�f.':,t�,tx�:.' � fyA4S— 7 r ��t'fii + V•til r ''. M , F,�� rl .'1 lieu of such perso,ilil service khen deposited in the United States ', •`►F�! �' mail, first-class postage prepaid, addressed to the parties at the r��` fist "„ �L nrtit:Z.� "tih ti_ry K r•��1 Iv , 1 • tt�t. i4, - '� ✓`��' `�'a rd err-. ( 11, 4�; L♦� addresses shown b :low. SELLER may change his address fr)i• the it itP 4s,stj� i f ''1r r��{r•.i`�A�'f'1 t► � '_ ,r ,�Jat S ��t.�r'riC,f A� _�+ , J purposes of this section by givingwritten notice of such changeef ,s�fr ` r to the BUYER in the manner provided in this section. s; �,��' + {l:"f f,•, �or.t 47.` .}YJrt �t rt i; t. •;t , }i�• ' Addrebses : (SELLER) Address: (BUYER) �� ; ? � s y�; .,7 c ,jt }ti ,•t =} ,f �K11>Ir, ' (Yi R♦(,`: '�5s' rrl)L � fir, 4' � - ,}') - ;•E9ta��e�'�of I' f'�' , . , •r,.,,.:• r. t \•� ' _ ` �, ,'Sylvia '�S. Shandrick, Redevelopment Agency of the �, �A� 40000/X�'/�Y1�� 0iW �460 City of Huntington i3eacrl q �/ ,,�i, , ;T,u�rr,, � �t�' r!+.1IrT i ��/ SIi��/��/PIy�/t��4F�1► c/o G fffce of the City Attorney �. F, of she City of Huntington Bea, h " ` ° a' " �l 1 • ra } ,ri; y tl�,ll'h !►7/ fix P.O. Box 2740 fit; �y �• �. '� r>°� i�, s''''r ijuntin ton Beach, CA 92647 y. ' c/o C. WILLIAM CARLSON, JR. , INC. ;. �?'� ,C' � ,,fit' A Professional Corporation ';U .+ • ' .�`;�" , ,� °` `�`_`' 2130 Main &9V/dWNAK'19 /�i' 91AfSrW �� • St. , (r Suite 140 Huntington Beach, CA 92548 4t)- ' ♦ r=, 'ti REST OF PAGE NOT USED Vtrrhkr t !• }t;}7�j}G,:�r�f��}f�r�{L�^•L�tiir l t it'r..� . )'.,,�rl i �IT S rf rr 1 ` tv .� i �SY a 1r ��1 t to It 1 [ir jy <A,'rt� IMF ��•�1r�, .: � f�,t- r a'�nY�� y,, �• i r !' ! t 2 ♦ �.ty� n .'.y�' wir.rSK /I•T r'i t 1.<<r! ?}lJ y�-,k t :•sue r '�•1,:.:'l �- tr !,�- �fi:{1 tt�Y•ti'� •:r�� 11 o ,•s • �' „♦,tY$ � � ttr `;^ ♦ t-'• � c. ,� .Sr ,..' J .:i.r! y rJ ' '�S{,. i! tt '��r Ir 1,n �'hJ. }lj 4+ ,l:Ji.r_ ♦ ft 11 t _ v �ff �•; 1,�)J,If/ v�;ir4•�}�� +\ 'w5�y�:.(., + 'r ..1'T ,1�-�. .1• .1J I � TC'^ •{I.•• ♦ L}r�{+..(t ' it1.Fi, ;',�lr r2 IJ�� ff ti.l •r .t`r,! fl •i, j•.1r).2 y+l ',t r t- ` 5•�, l> r rI'd.. �♦.tr f, _,\ f I • ; t •, 'it�' 11,G,''i Y�l'"r-�r.� �j � ,! '�p J. ►�: + ,, / � r 1 ,_,� >~ ri�` %�- r. � �;:.•( � �r' -�� f ,., {7l r t` r)J i`:: .4r): , , :{ � ! `t,t�Y�' T.r•l � 9tf L!'1 4 r,r x;tri t .•"}. :,f1 1.14,. ,,v7h p .r , .JN'�d,,t(r :�,�t� ,. '"�C;r<�•_ 4 ir ti'• AJ o ; 'i,.,t; �[';' i/,'3 -jl4s ' �, rr 1 14. 'L y,' r V. :i r t . 'Ir .J ,L%l.3'` trl�tt�t •j��'7 j�i`;\ 4' `3'{ � .rat ' �" (I,l�if ( <fl 1 iyl)411�'r1i,l 1;. i ,� I' ,.t t ty�,�,(t�1 �1 Cl�#QY :.; •tiS �' 1 • , 'r '�• ,f�� t �yl s T: / )� Cty-"Ir Cr4 I..r�ar � S r1� �•Jt '/ j Fi �, l l,• ✓N' �'►+ � t �i .r., , \ c ;�< ,) r 1 + t i 4v ' Ali '` 4�•, �' f i '1f�7, 1', G tt .v , 1 x!•} •:i L r/ Ta ,'t_ ry , t r• r I�,r � ni � f 7�'* ♦ h ✓f',/�`�`j�1."��GrTw( t , .� •5!`.�` �' lir6rF.� tr j`,. j�� .�ti �y . 7,, r pi�^�_ ��»•�''^'lI r1 +,,�r♦�t��.l .1.11/n�.t W�ii ji ' �f I ,r ,'1,,�J•:a:{ r` �Jtt �...i�t,til .il;.lyC,) �1�,..,i�a.�`: r�2� rTlt, r, Ito, 1 jf.� L f !^ • rl r T { .f b�, `� L ,, i �, �!� rr .._.�},!. Lti r�� •Yylr j�,i�zil.,�,)I}r'r rr , E.�r j.! _,,:1.�{tr}' li, .'1`2�t � 't•,.: s'•i�`Eti•� �4 ��/ytiyr j.,S��t �i�T1 4 r 43:i ;6. , ►,f,,..C)� i, .' ' ,,, 1 Y? li.! .J-Jrl r�y` ,lk,,,, ,i7 rJ ..,\'III r). l ��:1•r, ,1,. ' 1 .• C '�. � :��}.rt t I. t;+.'. t,��li, ^{4^ r ,I{I '' � t�••' '� j. "•t 'i � •�d� }[��*� ✓� r d 't.y�r �r 1 1 1 J� r t' !i =r t k:ir s: ,i ,�r� � ,r7 J ' k=L:y� r T,ry�',%: 'L rtr r , r yr',`t . , , r r- ♦ { ..tr r, 1 ,�•r �•,�)`'/ s•L� 7 • V ),;i��c ° 1 I .,r r!f •' r ti.� t y rr , l 1l .�f.(��'��. f' , ti•' ttj r} j 1 '{i , I { • r�'rlil'Ft � .'y # i;�� 1T'T i�af5 ( S 1, 1 y )t � .; frk'or J'� [� " 11 ry r. \i'• fr� f.r •'},•. r : l TT r ! �/'it r t!• �,-•{�;r r I' .,�� 7r�'11 It �r ,? f5., ! ,l 1'i t+ f"f: f�1•b` 1 1� 1� tl �,"+',•"• {'r e. F ��II r t, y •r I` r J, ! Z ri ;,i.. 'i -r 4•. xil!-;;� +,,� :il .`1.,��i .,y , ,S: i ,; i.J �1.'' r ,:`�,..= t4' yr, �.:, !� • i' } ,. , 1,1't t.i J♦4 ,► Ir•. .'i, r P ,'I; ; � .f, ,}i. •(t / t`:,'v"f0tr 1,�.� � it i "Ji' � 'i•,y:( j, •r ,r`r1 r♦p. '. I ., � };t ,+ ' 1 �';''1• :I:;Yf �J,S.. .)/.t'�.��, l ,r..1 , , ..' •.�. ' �}. •' t � t 9Ji F !' y ' f ,+ � .;,1'..r ♦. y--!,''. � C it ,1,.. �' / ,rx :. 1`�^' 1�- i , ,:'Cr t1� •i• �}S } r , .. � Y,' �I 7� Ytr+, �rr,C 1{!L r,,c /. . r•�. .1 1 r .r.�r o t. tJ,ei 1+. ..j ( ',�` /' , r ;) iJ`ft. ,!' �, •f/ rk j {1. • + ,'�� k - ,.... .� 4 � �t •' .,. '.r� f� 'r'y. •l r_ r JJ'•i. .:+!r�yiu�' r, '�i' i ! J r { T ,1"! �,SG rRi1 t}�t � t.. ri � ,, •.1t. r _ .',: � ..j• ! r.;.`;,i r;.`;� f� +•., '`�� ' �.•.',ti�' 1,Tr[` J� 11, .r:' :! — i1 ' - 15 / .JIA.lF1t`'�' ,1 '�1,`!;,? �.�y i, : �.: rt ,1 -lf. - , . •.1J ''+A y` . ,� s i'�,i•rs, ,,1 (i •rr�. „ .Jr ai' �' r`.,.• ':� .rF7 .°-°. r � '!1 r ` '/ .� ''�� `.•. ,, i',.. r •,..� S: `e .� ,;:r, ,. y ;..��,, : . ,;, •f�„'f at _ , ' •1, J(' ! - ',, t. -.Ct. 1 t;), ,� Ci !} .� �' .r;•:C7. :t7Y L r' , j :.-.`"�j .;, .�.w �rl.r;L r-`. �,...: Cyr.:...-. ,. ., ,, •1 , • ' ,'. r;r' ''r', t,• r' `r '•- '`�'1.��,1-7.., �a _ # � ?t:rf :1 ��:.. .7. (•). t l {�.. tY`f a .•-'�?. '1,)) r0 :�',v "�• :,.: :A .00 :, ,�� .1• ,, l `C _ • t. .'1 { 17 j. `�• r: li .�.. �' ;'f t• , .m 7Mp t,.r. x } +•: ) .,,L ..,r, •J�S .1 ,., tJ ., ,r 7 !,-,�.• -, ,.. h_• u r 4 v,.. A.{.., j'.'. ,, r„ .,., -� '. . " •. ,. :f' 'i .pL, . .jn•iN ;S I • 1 :'� j •' ,:•}ti:•1� 'wjl !.: ,:.r'{� „ .:{�' �W! "' '. 'r '�l � - . iMrl. • i b';l-}_....« t}Y+ ` i �..,. f r•r N,� r wt•_r'i ,f , . JTT ..'«,ri .;, ,.;..._ r,f. ^: ..,. �;,.' ..,K,. .f'S t; 'r' r' ,i• r� .�'�•`f•q...! "1 •i,��• `:.j • ,. .t ! t7 ,�` _.... ':,:y f ,-. � .�, )�.,..j• ,., .. �';•, r r r� 1r 7•` r.,•j1 f!. _i):,'i'' a ��1} , , �, ',a• ( .yr.f r ,•>tl 2, 'I .��1� •,lt ! ,r,;.. � :,y ��}•�'>.t•.t,•. Y_ }'., .r•`•``'� 7� ,> :ee 'i. ,A} ri / .ate` - f .1.': � i • '14 1.> ..! ., +[� ',,,'. 1 4' l =t r'x> , ry 4. 7 .h 2r• ;.4r :,, „/r q:.,;•, iYt•J � - r '•, / ' "+ 'i� "17tI a :. ;. �! - '+°• ,h ,�4 A}1 .. ..,E�w:i♦t.f`..t'..�r c:ta�f�i— �,,.{�j.r .•Y:1' yy",{"� r ),Y1r'_..� r�1•,. ).s. .;.y r;n,,� i•':• r .,. � !?:�. !':�� =Jti ,! ,1`'J \ A . I a.�,4<_,t'C.., +•:i•.`,M:/.Jt.Li , .rY'.tiA/:i•ti {'t-g}�; NRit r', z'r{,. l; r i:`. ,, �1 %.,pit A� r•r, � � / tti 'SJ 13. ENTIREAGREEMENT. :� ,�, This .tnstrurnent contains (', . ) ' the entire agreement between BUYER Rand ? �,fl' �°��`� l'•�,� ' .� , SELLZR respecting said Property, and .�r or representation f�a• y' " any agreement ptation respecting said Property or thety r , duties of either B(JYEI? >, or SELLER irj relation thereto � not expressly �" t� � ,<Y sf.�r •:; `r , :r '+ +r,} get forth in this inst u� ,- 1.� .�,.yr � <<!rr r mee t is null and void. ;!�;t;iq� �G�� r � •> , EXECUTED on • - n , r j , • � "r ,t)` '.VCounty,``r ,� �` !� ; r ''{..t�+ -^--'----•.�i=,�l�----.---.._..�...� 1968, at Orange �x � 'l2r-3 �, California, f ,!f 1 j(r erM r,+ ct53� jrt yi fila, t4-1 ��"�t c fi J'.ir+ t.,. r'r y i` �'g�7��4,r ft•f r �t;'r rl )!• r16 SELLER: BUYER Estate of N ,vr zyr, rt*) SYGVIA S. SHAYDR THE REDVELOPMENT AGENCY OF THE r, ' ;' tt rF , , !r CITY OF HUNTINGTON BEACH,a star, " (( � By. �- municipal corporation of the 1 ,� 7. State SHANDRICK f Executor of t,ali torni '� 400 id j 4jC1V �t� i�� Ch ,man ib sa :0 fl�i dryPMW,,� 2�'1r T�S'Sl�•'„'4 V� 9 AM Y '1 ri,\`j_ 1 1 ` 'r'L• `�"r�}•t r`�,` '. ,,' ATTES:P• AS '7 O POR Agency C.1erk x i Itr fr�r' � r � �, ', '. 9er1c Attar 7�� 'A ' A IATAND AP Wp0. City Ad ini•strator .. ' �,,,) '��'Jt•:,'' y City Adm nistrator/ fir. �c ,7. ; `' Dire h r of Community Development r r7 f = N.A , + r IV t I,4�S• 1 1...U_ 7 l•`.^ram!�' J1 T7J r ! i• 11., c !:1�,1z, -y.:tr!,, � � �' r�r►�i �'�`""r'5�� S, a r-L,, ,1Y c'.;i 1 r Af• t ',! I >, t ,T^ ,,• r 1 l,.t '. ' ! � '��[}'w t(t r+,,�I`� tia�,�:.;,' t{ SS/'•�i ,' c �,}, Y. :� ' t�^rrr!"f•'1,�✓J t�x�ti t:'_ I'�)`/L` � '.,1)��t,•r wy��: t�� ta�'i1��St�S+�'��4, ,4�'.��!'�t►'.i �•: ' �'�, ;, d .�Jt a%� )'^_)ter 1.`:'' •,f ''�r F� `) ltr!, Z i' •9f�'' ,f -:;{ :✓_ ) •r?• ire... �F.t�•al , f�. t. �'!�' t'f .ra 7 I,' t '•j« � r", T , 1r r,r r , :',,.( , r ' !�+ r :r r :,1'�{ / _.�ryll r,�-(,+ '4`• rJr ii J 'S, r !.��C` r !::. n tt "C I7r+S. '�� '',�f '�_ 1`'�X„i t ' 'r)r 2y 5 y '1f '!+r' ''etl«� t. J t,i; •/;': , •'}.;1r,. , icfy,�lj� •i`�lrr ,� -J' 1! � �'�, f.,r,. •i•� �•r .. ti �j' ..� - , " r . r tr (f ir1, 4'[.l r" f�;/ ,rt: .It` ./" 4' �, ,�,.,(�f •��i;i•!�% i 'rl.ttr 'r y� t Jr:r) + r� t.',.y \+ ..fir �, S••.. r yA,?�it � 1t):, J';r';;r„ �,�;"6t{•+'�,� n.1.!,�,• fY�/�' �.1�' ��+� j. "��r'�ri�i,r�t.tit��.'f�.i• i r >j. !,t'Jr�. s7i2 `�tj •",� Y. ,-�: ' :+i:A t ,� t '!, 7t•"'�y,!�'' t'�`^.'�i�' '�, Y 1 t i I, a , �!` w��r r t� ,(,r• y:. . ., t ,f � � :;^! � 1 ,ctr `�_�; f"�t); ,�� ,, ,:, ,, t r�f;� r' � , ,: '� .� " s�, � �=��' ��,.. ' '�r � (1 rf. .t. . 'jj�J3 �t ;: .'� ''J � �} t11 -'�, , � •yi, ir:!; I R r !i��'�: !J j � I 1. •X,��j7 y/ ` r�� " 'd �.] � �K•.1w�,�at(1111 ' '2'F•rt'!?.�,•r;iF,rf !`-� `i •U�r^1 y�rtt 'rlai ,ti, .: � r ri r 'i�! r �� r..r�r? Yt ;�° , ss i, ♦ ' 1 1 �rt '� �`W? � � ( � Tee a l�l I ',. �7 -r t { 5r5 �f tIt' i + ' � '�.' T �V'•Sr• , * 7 \ .' J� 1 \ !Sf '1 ] j' !/j{.f ��) 1 �� S�e1 yj',�_{rt !t -. it iir.� a + �,',�,C't I` f r r .�, F' 1. !1 {4 t ' tr,? !' } YYY' y,f,•I 5;.!' •K•!f :1•',' i '7°,�"'•Ji}!} :a`'l.,I,Y•, .,_�ye �,t. ��,Ji�`,.;,� r�,•�� t,.t,re�•1i;r't I�T`v�,t �,{■t,t'�%{ �f.{,G,r'ir^C'I��f�y3�,ilJY )tft-�y��l�,� n�r; ,1i r.T . t ,�:[.y , ,. Ii..A4r,.J.?..(. , .. �, •,q P ''' , - r ry'A ��S`?-�f '� t � e�' �s� �'r7 1.� ,i `• 1f- �� >, ' r.• 'L1fa };1 �. ? 1, i . 't�,�} ' t �r � (' , �'at� F��r';1 , � rf�t•5.f;��,�'yt"i,e A�, �ti �� tilti , �,� r =rt�rA 1 ,'�. ,' , :'3!t ' PaP`r�• l,,�` .ff ,', r •t• i2'.'S 1',j3"�. �1„i)�\ !!' ,[f{, ! { , .J,, f ! r, �h' •tt �iY,Tl �.l ., Ft { J ,{. r r r-,�2` 41 t {.thJt ..}•,.}.,. . ' }�#1 ', r f �r f'"' ?t/' �1r ;� h° r 6r ,� J :'lf { �'?•,4, 7c ,'1.}j,t� l"}'�':�I��t• (��^t� 4 t ,f i} 7rltl,t.:l.,'f r. r{'1ttr= }tj,�,,i�itr •'�"1j- i1} lr Jt '.I' `� !fi e �. r)l :'. t t• T -_' ' ...3.�. tt i a �'i. ,L F T '! �mot,,•.j,. , 'Ylrl,V,p�) _•,r it l l..,t�4 �, ;t i 1+, '.F� C I,k +..�1, i+. a tµ�'� f` i F !• �� ,:�1 '(?r:;t'r''r�y'�4r ' / -1•, !rf"x<� tJr}:'e �5t. j`i � _.Z�t),,�,; s ,.� JJJI;, /�, , ,. ,, { i,, yl� t� Y` C' Y t.' �r •.t `' r �4 1 .F" �''�t. , ` �'jZi J!•^',� •�';.riZ•,rt 1 V,��' 4 y.•'t!Jt '.iy`t;r'f t �_.t. r •- r.?fi, , 7,. i�/�'.',('' i f l:v;� ,�."J� • JTy:; �'iy�;c 1} 1�+ .�r• t`t, 7 ` tries R)J,',�! J:�.hfyC jl•(�r��>. 1t 'c�/ti�;,lre'4,} r r r�.. �j. :��/ tft� r,, yet, ,�•¢.•t-,f•.�r; ,.i�'t ti, �'�.'f(l�Li..,;�,�,'t� ! !W,r yia r"S�'�`' 1I';:"f.v��M`�rJ ::' ;.,, ��+j�.,•fi,,r- f �,A 7 1 };! •1��f;i'� rl ,r1t�,S�,)�'�.:t l.A J(;:s�f�,��l t��'rr�t%,�W(+j. :,Ci� r }/ � ! r �� '•li f,�'.,\,Y_ 1t�(r'{'�,rtr[t:��' rl•• r t^Ms Ii :' it.�'�'�1{S fy - ��r 7Jr r i ,{ ;f}J7�;la,\�fi�},�,,.•}lA�e[) ;V:•rif�,7.�a�,��)( l'.r j:..i�,,r�'� 1' f1, r.ZrY N � t;-TO;,t:J,.�r� t��'/• • �A 'J'i }i.!{ 'f?l:• Si-'RO �,�if'I ' .r,IT••r�'^, I.ii , ;tf � )., •t r••l�r,.'! y .r� J.� , +_i � .1:,1:r�P{J¢• lr tr,l�.�flA '`n f;tYt,Al:.,�`'-i,jr 4..\ t i .', .t ' .�y ray',� 1, ' .�t. .' • �t� �, V .. i `` r��.�•� +if !, • 1 '�1i•jFl L.7 41i t ?.. y (r ;,r , - e ,• r. ;1 . 1, ��,�;. �,•` ._.r.T,s. .ap', ,. .. , Y t .7u w'i'i'- ' p f� lr: +'t . I'..:"aF ire ,•,. ,. ( ,'. ..- �` ,•-.y _.• .': ,.,'�'llf ,s :. �} t+�':fj : '� 'r'f 1( - 11: �r ,1�. Y jr..17a. f ..:. , y� 1 ' '.. +' , 1 .i i1 .-7.,'� .,: •r1'.', '1' Ct ,1!� ,„ Z• .t ..t+ .,. ,- y- ;;t4+ .•,v J 1• t^ r, (I ,. it .�' jJl �i Y i{1� , � <, r ",;• :tt 't 1•-'i' �r!j 9 , t'-•l .: .y. '<' �'' ,.Ir. 1 i^i 'li� ? �• I.t ( S. i :1 .t A.7� it t r 14), d ,•... .. 1 z �f1' - {J ,,. .• u r � ', ;;:' ._, ,,.. '� ''�� 'll .-✓! 1• �, �' •o'� 1y� V ,. : 1! 9,.,.,•+ 1, ,f .3�1 vrt), d1 /1}� r7 Z. .(t " '!� Ii 1, y, t.� ,1.: :r f Y'Y+ ✓ti i. � .. Y.ti . .�#��{•�:` .. .. �:�'7'�.�,�. f, -1) ;7' 1_ I rr IK,'1 :i rl[•�i .,r',' T 1: ;1. •Yti�'f. _1.� ., ++ �'frjl' ., '.<5' .' i. ', i'1;'.•+ r ...-. �1..'. r�. ;� -., ,�i 1:. 'fl }^,' „ .� �i�i •�7i.-�� ;� `sy t •~��. �r':' ;•w: t 4 (.... . ,•.w 7ht 1'-i,.N:, •rr , ,.p5•-'•� 7.._,:.r .� .: ,E -. ,,'4� •il /.r ,,'• '1�s•. 1 t. u,• {. S.. V. .. At -.:•f, 1� .. Il K t ,,r 1':'.�Y ,.. /.� rl, �t r•' ;r•r.-,•1 y,. .. - !`x;J ^ If-. � .•..'� t�� _ �`_^"� '^�` , ..N•..,•,..V••rt. ►I� i+ra�.(��f a..�. -._�.-.....1��.-w.��.r�J �" �`)r IC�,,it11�l,,-�,�,yi J f� l dri if y t I 1 �r rUi(ER A�SQ�. 6. 7. t938 tll��' F, 3 1 i1 lA. 4 r� f i'tj r 1 ,• 1 I t , r�ir� �. •�� ` �"-�M.f• \ I J; • '.r ,! � Lr:� p�-�f .1 t rxlr, Z�`/►7•=i�t' 'it', v � - '�. r, , y, r !r � l i„ rARuEI. :70: 24-1 47-.10 TITLE REPORT NO.- OR-1�`1tJ ��^•I t3�'?` > �ri� r'•tl ''t�, ,�r � ; ' n�.' PROJECT ALAI i,� oy,: t �,f '�•.s r �'- �_�� "� �� H-PIER FEDEI LLOEMENT AGPEDIF.N FOR ACQUISITION OF REAL. PROPERTY ' (ESCROW INSTRUCTIONS) Tt f 1 , ti� - 1 1� , •� ' ' -'i r,S" THIS ,V1' t ACIREFJII is snkEred inL'c thisday of 198_, by and , fY l { between ► ^ ' EYE P4 C Yu.Tz l the RUN BEACH RED LO 11 4,T AGENCY (hereinorcer called "Buyer"), and 1 1 > r ) (here..nui t_r cal_ R t the undorsi ncd ownvr's + y "Seller") , 7 ; C q Buyer of fl d •: K + J) r , �. 4t. r), �t r,}•+II, �' errain real property hereinaCt:er set ror ti,,. +�'+ 4 -•� r , . ,r , ., y .,. .7 � i'�i � �. •a .:' _r g � cufor al; uisitton b �. 4�• >,1� • ti Y' 1 '� , 1 ? 1r � o x r 1'l.Tt��„ ,a��'rR �.' •t IT IS HEREBY MUTUALLY AGRESM BM TEN THE PANTIES AS MIMS: ?x r'y1 �j •1 ', i ` 'fTw;.r� '�'r�(f' 1' :` � Uy � 1 .b �,,�I,+ ir,t � r 1 •y '' j �`rJ�'�i:-1>�l ;1l�t�,� '� t �• � , y(•,� ;� `r'E AMEMENT TO SELL 4ND PURCHASE. Seller agr(:es to sell to Buye , 'dnd� Buyer � ' agrees to purchase from Seller, upon the terms and for the consideration Get for tp � r 1 1 p t.h �� i r W17 7 ,re 1 t in this 8 reemont all that certain coal ra er n „K $ , p ty here d Property )( !Wafter callsituated in the . Clt ' of HUNTINGTGi! Bf'ACN G'ount oC ORANG>r Statef California and legally described as follows: qi Y 1 { (4. c1 11 11 + 1 ' ! P SET.rt EXHIBIT A ATTACHED HERLM AND BY THIS kCf iREi�CC MADE A PART HEREOF � 6��y�1 ri4tr� {'i rIt t tt+ ' 3 i• ]u1f 71 ytt ,,;.{i ,Y 't :y�� C a:•�} � / _•1' i'l 'f r� ,,IS t � ;` {''f7 ral�,f,��+r. r t '� r,".`.11t �+ 1.7jJS� ,.`•r 1 ; ,�.•rt....li ry7','.� ,tfr� ,r - ,�j ��.+7 Vy��ti+'��>�`',�M�,�•,f , ',�:ty��a?,,.:1.r�ti14 ;YE� 1,: �,F!�t.',w}y�5f1,^,,.�al.'�. ai. r� 'y _R �ffil�� ♦ '^(a 7t r �,., ;►.f r 1` + JQIj •5,!".'�r~il �: �' 'f.7•r�(� A., 4,�,' ,1r•- ), ., �'r � 'i� ,Z{ F' 1 'Sj.' ,tt�l'.�,1'�`tt''�' ,rjT t+''r ` `►; t ', Excepting and reserving all oa 1, hydrocnrbon substances and minerals oe-, every kind ., '�G"'rill r } and character Iving more thaP. 500 ,feet below the surface of paid la::d, together f' f� n 6r t:t with the right; to ..:rill into, through, and to' use and occupy all parts of said, In-id { : lying pire than 50G feet below the surface thlireof for any and ull purposes , (Fqt{` incidental to, the exploration for aid production o vii, gt:9, ' hydrocarbon 3 substances or minerals from said or other lPndu but without, however, any right to ; 'r try+=( nr� use either the eur fare of said land or any portion of said land within 500 feet of Ir; a^ � {,`r�ytt c the' surface for any purpose or purposes whplso"ver .. }; >1 �'% ` '1= 1 .ark•. 2• PURCHASE FRICf . } c ,, The total. purchase price, payable !.n cash Through enCrow ;` shall be .the sum of ss, THREE hJNDRED EIMM THOUSANM AND N01100 DOLLARS ($380,000.00) 'Y I 'kip r 3: orryEYANCF o ,Cv._. . TITLE/ Seller agrees to coP.vey by Grant Deed to Buyer :. marketable fee simple title to the Property free any; clear of all recorded and is �'�� ,r, er r•► unrecorded liens, encumbrances, aeaessments, easements, leases and taxes EXCEPT; A.' Taxes: FISCAL MEAN 1988-1989 A LIEN NOT YET DUE Or PAYABLE, Qus9i-public utility, public alley, public street easements and r-i h'ts of wa !. �'•t�.'�'7`lr t: of record. 1; Y r rr t`ft� tl C• �- Items numbered 1,z',3 � of the above nunbered title report Ax ,.,;t t ��xyY`, �i issued by FIRST Ai'iC.RICAN TIT? !± INSURANCE C04PANY dated JLILY 1S 1988 7NSURANCt,__P0LICY. Escrow Agent shall, following recording of, deed to Duyor, provide Buyer with CLTA Staridat•d Covorago Policy and Title Insurance in ,the: amount o£ $380�,00C:00 1:issued --by;.FTAST'� ,4Er.ICAN TITLE INSURANCC CuMT'A NY showing tha., t..le to, the ro ert ' vested all, Buyer, -subject nl 'Lu Che; axes rasps ' = p P S y , set £ccth, ' in Paragraph' 3.-ImdtX DKX�?i7tX�I9fl:XkXO ��• ,� �' _ �ttk�yxXxt>��xx�[��cxxl�cac�xpcxz�€x��t>�rx�xx�ca�zpcaax�0ax;t �;, "3 lt: c 1 ti 51 r U er,?, }u ESCROW.' Buyer egress to open on escro�� in accordance wSth this Agreement L . f. INS i • at FIRST AMERT(AFi .TI7 E f , ; PANC.I. t.Cr1AANY ;t - J, '7nie Agreement constitutes the ,ioint escrow instructions o''' .Buyer and Seller, and r'Eacrow Agent to :,whom , Lhese instructions are delivered is hereby empowered to act under this Agreement. The parties"hereto agree to du all acts necessary to ',:lose ; { p this escrow;:!n the shortest possible time. ,r t - ; r• Page e 1 of 4 't a • i •r 1 „ Ekhibi.t '•An �'rt�ry,ry r'e ,`"Y�w�'**sw♦.e�R•r+a>,►+vr�,...,..+.., 11• •�. "ll/� �'f} lj ��t.-./lr tr +i! ( (1` �r{�,'•�' • 1;..i �, ••l�i;l '�' ll `i 'ii r• Stir: I•r '� D' t. +�•(}��j�r � T:i..l :1Jr�� „A."ty/ ^r•' •3 l'1�'�. ',: �� Y!�'c rI 1�• a r! Lr, 1^ +" f ,�:.'� �1♦�`,K r. rr ,.7hlf�ny'if, 't�j'1`',E,�/. � ��1 e 1 �',711�. ,�; ,rt1• i :'rv' f,•t�)t.'�;: tr t,. �' r}).. 4',, ;r •..� ,1 .i• r r�T (.,.,rSy�. `c �'�.4�!`,= tJa'�t1..Crc1� 'q��lr'•i+ �;Z6+,E'f'* �ti; , +, rlij'.�tit `�.I.'E,74+�3l j1'r »�'}tq r t��• ,. '.1.1�r`, 1.3.I��,. ! { .�- ' t .1,� ;4r ��r17'1,xi •.�r'�h•%11Sr1',,`Y ,`' L. 'ttJ' •�A�Y s tr•i. , n;3\ fit.. 1}t y,"! f✓, r 1 f� f(•l, !F' c.fl :lrr�j,yp t l�{' 4 t' rr l t. rd4j ' Fi •'..1 , If.+, ' t j.3.� ^,rry✓''.t '•t' .S�r -�`..'.✓t ti� ,� .,t},•I ;?1 ".t-M,f+t}4 r�u,,;r. 7t5', r<�1 rt' +;�.F�!.• ( r i�t7.I y,77, ',,,J :`,_� , :i, ' ...t y.,,:�'tt, 'ylr,.�,,, r '-i ,^...fl,r�•, r, '>',13r' •r f` 'at�i,?' ( '.ti't'� • 1 , tl'q 1 ��. . ii1r r•:e•i'� U,,;'. � ,*,.( .--(s�,. , } i ,r, ' � !!}'yl , N'1,L��.-+i -� �• ti �t..li'. �..��•Ifi� 'K;{. '•r ",> � `t;i.1 �t) �,T*,r,,^ r.1 ir%�. r/ -1'r ,,, '�!,' �r ',.'� 1;.'C, �. •1'-. 1t'.,]] 1•' ii., s.r •.1 ;L' "'�i.•t,,? 'ICr,n. .t"",-7'I: 'fit t r• ,�i 1f' 't''t7••rj�, .t4rlll�, ..:'��,. , �,J,tt, ti, , t1. t,.i ( %}' I1 Y =_ • t,a' y' :r.l r )• !•'•r, t• { '! ,4 ( ; /, , :IZ'! ,�^,•}pCp`�;.>,�rz.., _ '�7. ri 'l• ,V : T ri i i, •.�,l.i r..11::' Yi•.1 'vr r,l A' ^ter..• 1. ,:y;. ,�' _ ' 1 � i i ;t ,l '1 , . 'tr ,t ' .T ,/"�.•. �+']'wy!;.r , .Sri. t:{f ,�' ,l' .� f.tr{/ , 1 ..-�, ..``: .�. i, , .•••l ?r- �.: - / t... ,S.l 1„ i 'l i- t'l7t y,'i !' 'f' •' ,` •. �r `• i '.rl:° �1 , �'�. `S't ; ..Yl. � `�. e ,t 'w', t'1 .l'1'• ;)i a' ~� •( r ��` .�•{ . i,','...y .:jt�,, � y'�� rr;.,5: �, r / ! f S; �,, `� {, ti,� ac ,.,/ '/J, 'sal,•t� .� f. ,l •,, t'( - _t ;;, i,, � r , i,�'f 1N'a„•� W. '�� `r ... t�f LV,'�..1' •:. .' .'� l `.:.. 1.,_ i_J_� .'. -'-,t-1► 1 �� li a} , '� ,' a .',, 'T�t t, '}I { ;.,. '. f � tJi r. r fir,.•`l�:^.,�' t �F '':'�'i",�C�J•�t i.•,�J" ,�.a ,. .,...,�'-:.S r.,tF 4 •''' 17 �S f l •tl '� r , '!�, 1 ►. .fe.; t ;: �:_ , ,, '.2 rl �t,r, l� ,� ;�! ' ` �;•It5 c.�; t ti r�t,,t f::;:�'�� t + �.'J',ice:! ;y •y'7. r yF" r',. ,a '4.. •l..t.. ..,. 5•.,...� r` •dl,.`t i .� lr ' :yt •t t � ,'r'✓'ll`,f•�iSYar t! • 7)� tl�,i'Yl r,-s, .,. ('..' :.p...� }' ,� '1.:�� ir •n �! """; �. 1..,.: ��.1r`, ,n, �,.', ,.i.,�, '% }p, � t !�t tzz 7i.. , ,�.::.. ,:[^, ! 1 .. { r. ' J;. } ,�'� ,. .;.d. �. �: ft' _ t �x !`'�.•:'3..� YY S4. .I. L.ydy�F t `1 t t �.......,. � .,,.;r, ..!�i , ,i. ( - Y. -, ;,,t .. •..� :,.� '�' `- •;:.'a' ..i. .:��Y'�' �7 ,., -:�.,, [[ f�k'•✓� dl ,,,,�,. :.•, f. �, '^yy, ..S'1 .' ./ ,, •, �� t.. t "' {' l ( `f rKtE. -1 .; '; , : . . ...'�,� `- '_{• ��. ';�;. t,,r,1.(, i,',: „ r +;:iCt. t ,:�� / c; T, `� Ott }1��- �•}•.,a. 4,'��d - ,, !�:'y :•r �, �,4t ,,f.•'�Y�, F�'fi'�: ... i -.!.'. ':;- '' .i , _. .t 11��ti�fc'Y ,'�: �.�r 'S t� ��rCR�' ! -a ,':. /'- 3 r' � ,;ri":. ._•..... 1-'�"'.J-+.r r,. 1.r�., xf ,. 1}jj.lt .V y�,�:. .J�., 1. ',. ) �vT' ,t, .'i� ,r:- �y'H tC�� , :� ;•� ' 4y, r' -i i ""�t:rZt�.r.rF.iac+ii..t1.�'j�Si. t" 't•i+• { :i •r }: 'v, .17: !� ': .1�, r ? �I.y, , ,��if;,ryt�1 f Fti' ASL C:1f1lOi CUTL, ..._....:w r _ ._..._...Il,. _..-�- .�t .._..._........_,.._ _'- t•��: •="[�,J=• i�� x!. , 07 r,� A �•�LrA� t� ��' ' �'� �y.IS, `'~f1''�j 9� � t°1� [tF;J l,. AR hnjta.t and handed a deed t:, Bu' ar cOncurrent:ly ;rith this Agro..mont :ti ,� r '"` As soon ay pnosible attar Upouins or escrow, Buyer will doposit the &11RCuLetl Joad, W,��*•.� 4 ty +� ! r� with CertificeCe Of Acceptance Utpched with BacroW r )• r 11y' t'i ► ► > - ' , Agent on seller s r�'htl.., Tt3� !, c �, (1! C. Buyer agrees to deposit the purchase price upon dnmanli of Escrow Agent. Buye;r nnli u i . 4AL, iY , �\ Seller agree,, to dop03it %ri.th i escrow Agent any addl._•ioval instruments asmay be _ • ,. },� a. 1;t 4,j r rlacebsa:Y to 6onpletu this LransaCLi411, ,•k ,�t ' Insurance policies for fire or casualty arc not; to be transferred, and Seller will cancel his own policies after clo:c: of escrow, r "�'��}� ;�,r t�{(•�t11' yeti ' "+ohs ttl 4' f{�C •�. ±.Jai rr�5� All funds received in th,,9 as,!rotq sha.l be deposited w1 th other escrow funds in'' a ' +� ;i '�4;�r ` general escrow accourrt(s) t`id -• f,ay be transferred to any other such escrow trust +' ' ' f �r1,•'�`�;ir ;' a4` account in any State or Nations'► ba0 doing business i.n the State of California. s All di.sburnsmenis shall. he made by check f rOm 9UCh account. S,�Y4:, �'i!•x'��ry"� f, riZ ,,a• •1 _r ACbA'1' , IS AUTHORIZED AND IS INSTRUCTk;D TO CUB}PIFY k'ITit THE FOi,GGWINC TAX ` �,►� ,;: 1�` �' ,�' e `! ADJUSi1iENT PROCEDURE; --- , t t t •j(IT rFt 1� 1T r'4+r 1h f tr r4j�7 t� 1t J A. gay >!I:a charge Seller for any unpaid delinquetlt• Loxes and/or penalties and ;�',.. ,t/f� , ��r 1i , , ' , 5• in,.erest thereon, one for ©ay delinquent. or non-deli'aquent asnesements or ;. r </ t >,• .�, ,�. bonds egainst the property iJ; l r ,tsl�,r>rt t ,'tiS-,� ► 4� i ry Be Escrow is not to be concerned t;1Llt lrut•aticut {n, ! t •',�St fiscal year 1.f this e3CrOM' Seller's tFJXe9 t'.nr the current clt;sea belwecn Jul 1 and tlovefnber 1 un].ese i.' �i � �ti•` r current tax information is available from t•.i Ll,e insurer, in the ev t tax information is available Sells:r'3 taxes shall be prorated in accordance with Para ra �h C below.8 1 Frcm .luly 1 and ensui.rg period , when tax information h' � i� t is not available, Seli.er's prorate portion or taxes due to close of escrow, ' �� shall be c.,%rcd and paid by Seller, outside escrow, pursuant to provisions of :t A rwat3� s;,,f Section 5042 through 5090 of the Rio ionue and Taxation Ccde of the State of ' California „ r i rvi�tr�IJI g irjij ,' �f C. From the date that: tax information, in available, as oer Paragrailh B above, IA to and Including Juno 30th, Seller's current, LAxc;s, 1f unpaid, shall bo prorated to date of close of escrow on the basis of a 355 day year in accordance wi,ch Tax Collector s proration requirements, together with penalties anti interuat if said current taxes are unpaid after Docember 10 rand/or April 10, At close of check , escrow, payable to the County Tax Collector for Sellers prorate portion of taxes shall be forwoeded to Buyer tc :_,� •-;� ' `', f!j' / �, with closing etatemenL; D. Any taxes which have been paid by Seller, prior to opening of this escrow, ? �, shall not be prorated between Buyer and Seller, but sole right;, after close of Seller shell,,have ;j litt� ;sf ascr,Jw, ;.o apply to the Country Tax Collector of' raid county for refund, Thia refund would nppYy to .the 'period aftei= Buyer's r •t�: ac uisitio P �,, 4 n, pursuant to Revenue a7d Tixotion Code Section 5096,7. ' ; M.P. to AGENT IS AUTHOR1zr•.D 'To, AND StirLtr: ;� Pay And charge Seller for any altuunt: necessar to y place title in the condition nccossal•y to satisfy Pdrngraph 5 of this Agreement; ~' ' " i Pay and '.charge Buyer and Seller for eny escrow fees charges r payable under FnrQ �r a h G of this. 8 s arid costs a P s Agreement; G. ni9hurse funds and deliver deed when conditions ��.. ons of this escrow have been 1 fulfilled by Buyer anct Seller. ,Tlee,, The term "close ,of escrow", a and where wrlLten in these instructions, ,shall meat ; the date' necessary instruments of conve•need r f are recorded i.n the office of. the Count; Recorder, Recordation of instruments delivered through L'his`escrow'is1,iu©horized if necessary or proper in the issuanr-A of s,-�id olio ' a x� n urance. policy f title r, t All time limits within which ` any matter herein specified is to be peii,?rmed may be ,., , • _ extended by mutual agreement of thcc y.. parties hereco. Any amendment )-Or- or �� } supPkment to, aninstructions must. be in writlltg, TIME IS OF �Tyr ESSENCE IN V F.SR IItiS'1'RLiCTYONS AND :SCRCW I ' POSrrDI.E, it !ex cep S TO CLO5>; AS SOON AS t for deposit of rr.:iteY by 3uyor, which shall. bo mado' by Btiyer Upon demand of Escrow Agent before close of. escrow) this escrow is rot in conditions to elose Vitt! 90 , ,P_,,,.,__days from dohs of thar;e irtc,t•r��ctions, .any-party who then 'shall 'x have fully complied w1Lb hts in4t:uctloaf; may, in writing, demand the return of his money or praper,:y; but If none ;lave complied no demand for return thereof' avol Page 1 of 4 t: t. 1 \1,ty,l.at yF ♦ItWC lY .!! �({ �t'•1. '� t F .,.wry +�: 1, y A 1r r} -.R J r It'•itl' -.1.:/ 'C +��\ n 'T�-„'••"-A of f Y- •��r y t ��%�r �g �~ �:r�1i- ! 4 ' 'f 7 + t i. T t ,i1• 4{ !l�ritt7�-�" r,; t. 'r►rrjl •,. � T t!l"1 1,-,.l.rti .,,r �i.. i 1'J7 �,,�,� 1• ! Y , 1 t .S f 1tL('�`,- ,a.�'13, tj r - '`� � �i,}y/f i•t --,� �.N � •t�,:1 F Ir�: ,.F...�� r,{ ;'.,r { ..`{ 7. 5 �..��. �, t k 4 1i�i11'Ijf{"r• •••1.tM'.1�r• .r'i ?![ji� !' 117 � t ti r y "•��•tl r.t 7F i."fi ({ Jr�4:. t , `t� r�..-��'It:�)t r,f ��» l�� r r '�'' * t,.J�.{1.tyS%t3! ,.. _ "1r1 11..n9 1 r�- t I/' �r►,.'y. Z Y.o . i�%'Jr.' ',w ,•. :r 7 1'� rt (,.,.r.' •� ..r.,, t 1 i2 { / ! It � t S �. „ , ,^, 1 t, . r, ..t� t I 5 :. .: C "•� �h r� ' �!,� �, • • • y r t . ,. .�, tw,l,! 7 W .r 1 r f.';. •�, 1 -',, ;� ...�..yr'�!-.4.}t , r �. r ,1�' t� •�7l.t�hZ t.+�• r .,1 1f�V^,�•t 4�N� -� ,i •� ` ,.- � ,• ., ,` ,F;. ,,y l;nf' .;'! y•.rT•.�. .', . J , ►;.... F�` 1. '...,.r •,� ,; .ti.'rt - a�,v.- 1.�y(4,7 !`.,�s .L�. ;,r��.�,rrt�•'•C p'';,t:{Y;�',?��' `•�}• 4 a. {., ,�.(h�1 .1 ri•tr Y.yb ��t (,rl. f f.t;� r�,�J,, S 4 �'j• ' if,�A. l,, ,-,, - :}1�. qq '.>r�'F': .r""'!i 7," ,,;y � t r�• J +�'. '+kJ s ,,� '1 4•. � �( Ur. ',r• ,t ,�. t� ,.% r _ ',, ..�_ ;�'�.� 5 r' "�.t� �ti::�•x�..�.�'t�r. � n;g�..�!:• j / f 111 R''1� t •.1' C „� tit , ), 5: tf •f .1 ,S• „ 1 •�; i '1( f' •t'•f r �, 9... 't::y.3'�� ''h�l�r y t.,.f•�.,'. S. :�1h .1:.,'„ . •',- a!! t ! ,1, r; ,, ,4 ,., , ,.. ,�. ` ! 'f,:,.t 0:..t�" ��1:. :i, '1 :!, " r. 5,t, ,/ y>. a ,;. 1{,� i` f. •,1��y�1, lr!�, y� H;'fil rh • i lY Il; t r t .� ,i. �,�i`�'i"' r��,it t;��?1'<+��f� �,� � •t rl tt /' S �, t- ••i t ' t i ,,�1�} )J te� •t {r: t t 1 -� - i = t•1 .t. .,,. , .,•1+ '.S; ►,(!� s. „ .�• .r�. •.�;��lj�.t;,`�{� 1� •t'{ � , '. .. ,�'_ r! _ ,� rJ t '1 .r 'r!. {"r • •st", ,j,tj ri1'tj, , ,,`�, f.,Y -_.: _„ n,. 'T' r t.,,- :.• ..,._, .. If• - J' ,' ;f ,, J.• ' ♦ 'JN1 Inn F� •S _ .'..1 ,, , ��- , •.., -�* ,. ';1s ' ',,.,' .,, di .r%: fr r,J., .., ,. 1.,,. , 1, t�.';.ti. c. rt.`,.-�' 1'.•: -. .•fr,. { Rr` a•.:. it •i �� ,r. it ; , tl 1.... t , .vl C =t,' * r.? ::1';��•+e`,.Ilil '_ ,•:'" :'ti.;a. , ,a `•. - r1'r t� . 1Crtl� f�;�.�.ir•i!. .• .'f 4 •t. , .:;.;.+jj �yy,� :1!"rY•, .... ' • /,�1 1 1 K!-•7i �/- ,. -.t.+ /+ ,1 It f! ar �.i' 't., -i�l .1�� } r4: , ,y ,`. �i: ._" �i r];"'Y'rat- i;.{j' :i ;5. ;v 1.r.. - ht J ,j.,a w i •, �'f'?'l� ;, '�t•'�, � T:.:_-. 1�.'" :,f''t'` -; 'r i' .t• 1 ':'t� 1 11.. r. 't .1 n i .;y "J'� '•' ��ij ``}.;'`G� ��j`^_�' '�., •�..;r, ,� ►; ;�� t'n,,jT �, :� ,; ��r S r�, ,�,', ;t , 1 �! { ..s�, Xt *�1�t r •/t .,d�:J � .' i:�11 -:��('{ `"°f,:��, ;;f!�'•. a. ..,u r 4' �r`t5�# >4u.7...rret iaJ'�,.:. -..i b•....�:rt'�.�..—�..:..t.-,.1►1 ...aJl.::�.._..._.. �ti....�-..n i...'t.i ..-.v.:l:lr�.. .1NY.W.'ti:lL,�>� jf.• X F.11'a4Y,tfjC � r� 1� �, #, rl. 1 •fi #, FR00 JO1t11 CUTLER t p550r, . :, S. .'abt) {31AE f. 3(77 i!1'1��t,�4ia, 1prlt'Y' .•I�y+"} ` r ter 4 Il : ", rr� ,t�t,t wrJ be rocognizodj until ive (5) drlyr. after Fecrow Apent shall hove mail, copies o. 8UC11 dQmanrl t0 all other pnrti.ee; 8C t118 r��s� tctivc addroese 3hUiln ill thf.'Sw inaLr tic tin , '' and is any otijactiena are raised within sj! ft:�r► (5) day' pr�rl��d, �t,,ll r`' c�tp, os Escrow Agent 11s authorized to hu]Il all papers and documents until instructed 1/y a rP►' ' ;�t�,aryt'r� �.4t•� ,� W j.`: court of colnpetCllt Jurisdiction or mutual Instructions. If no demands are made, = YYk proceed with closing of title escrow as soon, as possible. }' >�, ire Respore+.bility for Es,.-row Agent under this Agreement is expressly limited to PlLivagraphu 1 2, 31 4, 5, 61 7, 9, 10, 17 and to its liabrli;y under t any policy of title insurance lssitud in regard to this tratlsaLtian, ) r 6. ESCR FEFSL CHARGES AND COSTS. Buyer rsgrees to pay all. uqual f.es, chargeF, ��. s ; ,v •'.S ,;• .L cl} 1fi j and costs whirh arise in Lnis escrow. A 7 Ri- AL `A1vD GCCUPANCY BY SELLER Seller warrants then th6r : arc no arrtl or r 't� K��' rt'►, �' ►,I,t written Inafies oil all or ar. ortioil of ro•n'.rt: zxceedin a period of one month 'j1ti '�tt�"� Y P P � y � P � '.! ' r •�•i : it ' ).d, and Seller fiether agrees to field Buser harnlf eas and reimbucic Buyer for any and all o: its losses and expenses occasioned by reason of any lease of sold properly G`,r rr 'C; held by any ...ne3nt. of Sollcr for a period exceeding one month, except: NUNSrTr 8. PERMISSIO9 TO EI•..PrEl: ON' PREMISES. ' ,'.roller hereby gront.1 Lo Buyer, or its r��Of ,�71 ,, ti authorized ✓;gents, permianion to c ter upon tho Property at all reasonchle times + prior to cicLe of escrow for t.1e purpose of melleing necessary or apprurriatA ��; 1 �t inspections. Buyer shall coordinate wl.Lh Seller any such inspection rcqueats. �; � `', A.`1i., ' �l�t 9. COUNTERPARTS, This agreement may be executed fil counterparts. each of which' 1,� "' '•s�W ��'�Ir�f ._` ;• '' tl, ,v ti,.f " so executod shall, irrespecti.vo of the date of its execution and delivery, be >n A- �1 E 'V,•� ,` `+ 'ti1 { deemod an original, and all juch counterparts together a%all constitute one and the ''��,�'T}tr ,��t�i ��(��a•�,,.r 'r � >r r.T'.t 77�r`�1 93me inatrumrnt, CttjJ ter ' 10. CLOSING STATEMEI'T. Seller instructs escrow Agent to release: s copy of r Sellars s statement to Buyer and to Joh;% cutler & Associates, 3711 ..ong Beach Blvd. , Suite 1016, Long B_ech, Call•fornia 9UA07-3315, purpose being to ascertain if an reimbursements are due Sellers er, . � , . y t ..r r r ,Y " r ,./ t LOSu OR DANAGIs TO IMPROVEFICN'l:S. Loss or damage to the real 'property or any ` ,� improvements thereon, by fire or other casualty, occurring prior to the recorclati.on of the Dead ahal.l be at the risk of S►:ller. In the event cf lo5c or dt,mage to the y'?t heal property or any improvemonts thereon, by Fire or other casualty", ahall occur prior to the recordation of the Deed, Buyer may elect to require that the Seller pay to Buyer tha proceeds of any insurance which may become payable to. Seller by 1 reason thereof, or to permit such proceeds to be used for the reutorstion of the ti `� '• r tt,' xf,' damage done, or to reduce the total price by an amount equal to the Jxminutizn in r 34Y. vsl,ue, of said property by reasor. of s'ich loss or damage or the amount of insurance ;F payable to Seller, whichever is greater. �{. 12. i;MINENT QQ46I1i DISMISSAL, Buyer and Seller acknowledge ghat: this transaction is a negotiated settlement in lieu of condecintttLoll'and Sal l.er hereby agrees ►tnd consents to the dismissal or abandonment of any eminent domain action in the Superior Court of the State or California•:1n and for the County of Orange wherein ,r1. the herein described property is included and also waives any and all claims to any rtt rloney on deposit in ' said action and further waives all attorney'-'fec3' , costs, c' disbursements and expenses incurred in connection therewith. 13., HA'LAkDOUS WASTE. Neither Seller nor, to the best of Soller's Knowledge ,' any e {r/f •?�' ��,.', �L'1� previous nurser,' tenant, occupant or user of th ,lroperly used, generated, relNttaed, discharged, itorad or disposed 4f any hazardous +pasta',, toxic substances or, related ' ? f " '1t materials ( Tozardous Materials") on, under, in or about 1r 3,t " transported any Hazardous Materials to or fron the Property/. 5*1 s H no cause or permit the presence, use generation, raloase, disch; rg ',' storage or disposal of any Hazardous Materials on, under, in or gbrut, Pr, the .:ransp' rtacion of any !?aza:r+',ds' Materials to or,:,'Zroni, the Property, The term "liaxardous Hat eria]" shall mean 'any subste-ice, m?..terial , or waste which is or becumt:s regalat:ed by.nn;• ' local. governmcntal ' authority, the State of California, or the Ualted SLNtes ; Government, including, but not 1rmlLed Lo, any material, or substance which in (L) x� ,' Ie 11 u n i de,.ined as a "hazardous w �;• alto, "extremely hrazardous waste or _ ., restr_ctetl � s iazardous waste" under Sattion 231159 25117 or 25122,7, or listed pursuant to �r Section 25140 of the California Health and Saf:-ty Code, Division 211i' Chapter 6.5 ' 1 (Ha:ardous Waste Control Law) : (•ti) defined as "hazardoual substance"'under section 25316 of the Californie health and Safety Code, Division 20, Chapter ' 0.8 (Carpenter-Presley-Tanner Hazardous Substance Account Act)., (111) defined'4b''a r h 1, a � tlhazvri�us meter:'+.al," hazardous substance or hazardous waste,1e under Section eielsol of 'Elie California Health' and Safety Code Division '2t) Cho 'ter b.95:'Hanoi d%�us ` Materials nc%.leaso Response plans and Inventory), (iv) defined as .a "hazeraous substance" under Section 2528I of the California NeAleh and Safety Cod©, Division n t• t PAGE 3 OF 4 !{!� !` t��r R /-.r+-.f.,:•. .. ""[d" -^^.r"ts•^"ter. 1 -+;-r+� t¢r�F a T , >t, s Y ,.} �J,t t'=,, `ti f•�,�rr, } t,.�w ;�', Y�r1 yr [' lit N;1.. .r, T.t� r'•► , .., +• Yr`r��r; 1 iti,Fi �t'F.?�r t�,J{ r. _ »� _ , , 'i i,1 r ,Z•. 1i r-{t �'rr�r6U t:''i rrt j. t'1� a•i wr •� 'aiA.�'.tt }�•1:. V�X't^a '•'.'1�,� ',r• w +-: ,/i i` - t '' .tr, �. rrt.•;+ r ..; {`,:!'t trY `/. .,,.� J': ¢t�Y '��;,Y!y�j , - Y r '7 , , e;-7 i'i sr c, rli � t ♦ }t .Y, 4 r /, i _�' +j.�.,1'��'+ 1i � �<. E .�`i�•�1�. . 'r �' 1, aIc .`,�; �ty?,�R� ' J: jJ. ;�- •�+� 1 .Yl�.'�,'.,•r.��';2 ��: '� " t i Q � /'a^' •� ' l� • '. 1 JS''�I .y �''t� 11YJt •.,r r t o "*�...�• t. f.,r ..,!•t ,, r ('.' L.1' is 'Itl r. �„ 4.��1 (= e•.,�'� t „ !�•'- � t. .14T) ��r`,�1,!=„r` t t `� t�f'•� `.1�,f 4}f, 1 `- _ 't ..t , ,�rr,�,;iirt,rr �ti��ilY ` :fad( '-:4.�• �twv�y,,,�i� •�1,t.�Y��_�N• ,Y`�� f..,�t, �•:z�,,,�� 44• '�k�j '' '!.r`1,,-1 •fir ,'},r�`Gi�i;��t it�}S'ir'F i'r �t 1 1,�J=rJ , 'S r?f` 1•r�t'f r�,�'s!l +j:;y a,,'•1,�3.y�r,�.�r r�U, f ��7;,..I s ��C�I�i+• ' • 1 C'�,.•":'�,._� v��!�,a/I f,ly p!,. i(; la , h 't:.trt r �. :.1 Ertl t '. • ij3.��'Y`tr;�4� .•,t ,.a. r.?':t�f;`1 ; f- � ,`,�t.,• `,. ; •+� S Siti��tr1r' 4+',.i_r,p;;�st�' r7 {�•�� .�� ,tn�i/'��te>C�r�,+S'`L� , t +�/! or.l .t .1 .-_ ,'-1;i ; {t•;I,I SI` r t� r '/ it .y.{.,i't t'S�r...r,1! ..r,»> Sr! �r, ry � �: SL'f�j.:, r:;7✓r P� ��.r�'i ;, r �.' tQcu.;lai,j'if;, rqj'�' r .1,>! :•,, eft 1•:' r �,.' 3 t' „ f� ttiu j . ; j� � ., .� ; •5t3 M t`: �,., !a', :�.I.Y; V. !., ,..,. 1 ,}' �.J}' j ,"rC i %} `t77 , 1 J y' � � l �. �.q,,#'� ,l n rya E r •r �' ,�. .t� ,I.f i�• i�i' ,, iY,� ' Y'i•r}- \ '•f t•t f !S t ` ' 41, fl. ,' •1 ,1=.; �11 ,�. U. !r. ^.J•a 1 W. Y.• j �,1g17:,•r1•?t ks r�. �� ,3' ( S:t' r {.t r• to ,1 _Y•_•i'r� _, ,, t '.iJ. 1 t� ..:, ..t,>: { ,� i'l �,� `�'0., a�J'1•l .+ '� t� � _1 - ' " �," t l t ;1' `'' � •".• .. '�1„ �R.�� A�/r b.{r..,tt .�IJr�` ti,,�5.tt1�l, ti. ,,,,.,�;'A. ;J. ��•'� f f IJ, y 5,�. • 4,11 S+jam .e. sIs- it�t . t 1 �t r:.t' �tiuw 1....+,ar✓., .-+ r .... ......+•r.w .r.......r, .. ai#.. -i ... ....i"r.Z .-U.�..t 1-u.�.ni+u...r. l<c 1�, • l . r9... 1 t•I {+ '` : �...i _...a7S ee . ♦ S. °Q'+ tQ7 ••, P. A. t=Rorr�,o►ctr cu1l.ER c c__oc. ��++, Cha for p 6.7 (Undc!rground Scurabc of H[+r,:�:dolls Subst ance:s), (V) (!QtT'aleUln, (V+� t! e�z 20 „lot x r if 1,. asbee,tos, (vii) polychlorinated byrphr_n5'ls, (vi�i) ].1st:ed under ArLlclu 9 or de filled a , � t.M ou "hazar'doue" or "dxtrenlely hazcrdous" purbuClt to Article 11 of Title 22 of file +" It California Admi.nisrraLlve Code Division 4, Chn car 20, (ix) designated as a "hizard ,as auhstances" pur'i,.rant to Sect ion 311 of the Clean Water Act, ( 33 U.S.C. �`� �. E13,6.7 (x) defined as a "hfjxrrlJvuv waste" pursunnt Lo Section 1004 of the Reacul•ce s Con:aervation and Recovery Act, 42 U.S.C. 56901 et sue, (42 U.S.C, S6903) or (xi) ;j defined as n hazardous Substance:: pursuant to �NrLion IU1 of LI,e Comprehensiv+r ! ; 'rc: Envlronmental Response, Compensation, and Liubility Act, 42. U.S.C. S6901 et: se (42 U.S.C. S9501 ). ,i t��l 1� Yt i! C'rL^'[SST1irCL� t.2'�T—T.�Yw»"KC�7Ti'T'7W--6A�--T4w4tra 1'.'• .''�►"'t�t•'• 1 ,—i ��r'i•'�• � t 'e �/ ` A. ,� t', `all applicable laws and governmental regulations including, with limitati9tf, all ap. licable federal, state and local laws pertaining to air and water 9 rf ty, hazardotl��w&4i:e, waste disposal rind other envlrunmental martnra, inclu�lirt ut not limited to,' tho Cli an later, C'.ntin Air, Federal 'War•er Pollution Cn ral , Solid Waste Disposa R03ourct• Conaervutlon Recovery and Conprehensl%,l;"'nvironmenr:al �4 �t,.; Rospanal: Compere Olt dad Liability Acts, and the California ronment Qua J l t}' �' Act, and th3 rules, r gulationa and ovdinnncr:a of the City u nt:isrgtan Beach, the , ' !Kk Calirornia Department o ' Health Services, the Regional Control Board,Wat�e Quality' the State water Resoarcl.. t,antral Board, the Environrr t al Protection Agoncy and LA 01 applicable federe] , state ,r\d l.ocnl a4,vl1Ci,:s and ecus, 15. INDFINITY. Sel.1cr indemnity, efend an to, Buyer harmless from and against �.� any cl.^im, action, suit, proctedin 1c��t , cast, damage, liability, deficiene:y, fines, pcnaltr', punitive damage or pO1151? (including, without liiniu Lion, 1 ? atcorne 's' fens) resultingZrom, ari ins ut of or based u nn (i) the pre3unc:e, t r F, 8 P 1 lr� release, use, generation, di.sc.h, r atorQQe dlsposol of any ilazardaus Material s� on, under, in or about, or the ransp+�rtutiotl of a ' such materials to oi• from, the t Property, or (ii) the viol ion, or alleged vial , cf' any statut-,e, ordinanr..o, I,t'. t<< +' }' •"�� ;, order, rule, reguliati.on permit, .judgment or licer a relating to the ustP, generation, release, ischarge, storage, dispo3a]. or tr prrtation of flaxardoua i4 l; i•fateri ilt: on, undo in or shout, to or from, the Property, This indemnity shall �t F`h. l • : include, without _irritation, a ay damage, liability, fine, penal t punitive damage, ; ,',7 , )r '+ 'r ;`;� _ `•: �t cost cr exper a at•isi.ng from or out or any claim, action, suit; o� roceeding for personal i ur includin sickness disease at- death tan ifa.e irttan ible } ( � $ 1 1 1 g � 8 property 'a,^rege, cuTpen.,�1tion far lost wages, business income, profit Nor other �tr.ono c .a, damage the natural resource or the environmetit:, nui nc,., ution, car taminotion, leek, spi11, release or other adverse effecL an r t V. 1 16. CONTINO.:_NCY. It is understood and 6greed between the partie9 hereto that thee ly;" C01M.nletiOn 0f thi3 Lrensaction, and tl•e 0SCTOW created hereby, is contingent upon , 1\ the specific acccptanc+: sand approval of the Du)-l_r herein, The execution of these A 4. documents and tht deli.ver� of sane to Escrow Agent consti.tuL.3 Said Acceptance and f, _ t approval. rt 1 rt 1- I1 4 l A 1 �•� i' r t: , Ltr t,`•� •its 1+ s)} ,�' f •C ,.�St'•i .+ �'�) t S ? id 'Tires tarns and conditicsn-;, covenants, and atsreemants sct forth herein shall apply to is �• •1 ,i and bind the heir!,, executors, administrators, assigns and successors of the [[Ir;, parties hereto, 1f II IA" (1 This Agreement contains the cnti.rc agreement. between both parties, neither party relies upon any varrkioil.y or representation not c_ontri.ned in this Agreement. {'�, t`r Viz. it:t�; IN WITNESS WHEREOF, the parties hereto have executed this Agreement the day and • , 't.~•z ,;tt�,, i year set: forth hereinabove. 5� ;t� ;:yY , S,� � ,'•aKt 1' i�Y�� j'd�,t',�'X,',� 7,_ �,,�i , 'n IJ,�S�z,i` ,�� SELLER ESTATE OF SYLt'IA S. SHANDRICf� <3y1 E< MAILING ADDRESS QF SELLE�i BY: r JAMES ANDREW SHANDRICY, Executor 1is `, l 0"NVr�', r i d# '�• c!/o C. WILLIAM CARLSON, JR. , INC. 4 / t ,r A Professional Corporation _ c i 2130 14a in Street:, Suite 140 ,, i• a Huntin;ton Beach, CA 9264E 1 �,t i r`y t1UY L'R 1',UNTINGTON BEACH REDEV'r•.L OPME�11' AGENCY r � � `� � .�� f rt 1 MAILING ADDRESS OF DUY1'R94 , "k 20`)U MAIN STREET ;��, ;a •�/.tii•,l;� T � �tcFi`;�1�I, ►�.y,�il; Ji� � �!� ,' rt +• HUNTINGIMN BEACH CA 921648 `r;l,, h' �AIy57J1� Jd i, a,.y ►, ,h t �,1 +,.i Page 4 Of 4 ,Tts:j ■z t! `I ft,.+rr,,, .F ---wawasw.»e •s.�,..�.-v.+..»�..r.. .y...»-.......+r�r w... ttY t � a Y,y'., �. 1r .,, r� l ,, '' t �i;, -.. .t.. :r� • ' :, gr.w!e � _e,'i"•„Tt•7.=L,T t �� i i � ,� Kf' ' k'l' �� 1 •,1 "� �f 1� " '.1 ' it�4 Y ., t s 1! l i 111 ,� 1 �• 1 r� N.'r�� •'7,� 'r,. i .''rl l 7 . [,`, , „ ' IIi. ,1'�'A y �� .t: .�' y, j y,.� �i i� - , �'t '' i .Jl i 'a� t 1 t`I'.f i,' •I ,T. ��f ,ti ,.. .• f �. 1 .}� • 1 1 dr. i i'� ��J,,��. 1' ,�ll�i:,t ',• ,. - / I i� i ' r f'; , � I r• ' rl•''�1 ,' , ti,•,t fit' ., t �,U 1i. ila;(i ., �� r , l ,, t. . .l t ... 11 't� �•I•t. :rl} r .(1�� . ?J' ? 4 y l r� +,�C• v.P:.[r S<� t tj,;�� r 1 !IY ,t "�� t .t �, , r.:�,! tl .r r _ p,. • tr _iC- �...1.. r. ,,t l� ,.t{t•.'.3t+°t ��%''R �l ' .,�1 :�'. .r, �'..1 ^•t.` : :': .r.,r' •� Id1� 'r t ',. l t'.[�{ 1 ° t !3 ) t r• tf a �� l ,1i1 y i •o j�� l..c.i__ ��.,t.., 1,.. `` r.. 1, '+ � 1 ,.. rt,:f: lr 41,. J�� "f4 i .��i r��/��r. p, 'J ,� V, -h ''��j 1. .j. t - t _ il,:a ,�•,I. J1'��•��i.J.��I•,a l r ;'.� is , ,�• ,• r J � Q ^1 ► i �� 's'��'f��k 1 rF, Il J , ti,•i+� Iz' - .v ..y-: T' c �;.;h,, yr:•1 !' •.�" .t;��, - 1 ('•tf r .,1!! FI. ,. ♦„• ply: .. f'. � - :L. �Iv, +s7 YS ry.�j�jy - J{'F� t J t f � ,' :�i� � . } /.,may"�• 9 : A*:^N ". ,� '.�r.a''M1• -1 ,.:, ri'!rr r �j`1. ,ii + •�, f { I fit• .. � `4 f ��y R 1 `' tY�o titG7 �� C 5 ' F 011 JOH 1 CUTLER L AS50C. 0. P. all L�t PARCEL I10.._ZL1 Ig 0 •, f�yr+4� s II r � �� f� I N '`� 11 � ! ',!4•. tit JI � } jaw" LMAL DNjf SCRYPTYOH LOT 25 & 27 IN i BLOCK 204 OFFINTIGTON E1r.ACH MAIN ST M , ` . 1 N L"It SECTION O N "VL 1 IN THE CITY OF 11UNTING'TON HAM, COUNTY OF ORANC-ha "'ME Or CAWORNIA, AS PER 110 RECJRDED IN BOOK 3 FACE 36 OF MISCFMtAVIMU9 `'� �►i ,l �,�'- , MAPS, RECORDS OF SAID ORANGE COUNTY, '• it . '�� `'T : � ' `- �t 't �r ' '7 r 1 { t:ti�rl EXCEPT ALL cin EUN, GAS, MA, ,ASPHALTUM AN) AV S`�, K ;" 1a orlJ, r ETR oL KINDERED SUBSTANCES AND OTJ1 Js MINMALS UNMR AND I11 SAID LAND. L. -1 t t t 1 , T 3/r. T, �.L�r. M ,,•� 1 tl j• ` j i�t'�,, ,'�y, � {i�Tsjy1. + i lI t. r IV p :7- V r. t lint; ,:. 1�Ji 1c.', alwl ', tt ♦.,t f�7 �;�:IA� �.t 1. �;r,.rt �. w, �. c• T t> �. �I �Yf. ,•i ✓ S ! f _l{Y t Usk'"� 1 J} ,+r•'E �y��e,�i,f ti r IY1 j 1�1 Y 1 Z'J �3 t 1t41 t•. t, II� YI�r55f77 , EXHIBIT A" ! l � t'!Tr J 1 ^' 7_7,��1 �r •,. .,7J •1 �^.5:, , rr � ' ,j1� i A*'.Sy/+t� l•. �'� y✓ a t r . � ,T i ! � 'r I i .J *7 , 7 d S r T 1 t' ��• �r�t7 f, , ? 1! rt, ) . I : Jj t f► f: 1 S,t F i1^7. '>• •4 tlT�it 'ytr• f { r:`� � 1 rt41'. J - ' JI YI, • r ' y iL;, � •�. �,i,(d ' t 1 `''Tee ter v.zt-`l.`1•'11r's' `r(t.t�l r a. • 1 .l ;� ' r It �' r.l'Y3�, _, l�a1 ..r � Jr tf t (1 au Y ti yIr,�1�r 1 l ti !' , 7 I s •ti ,✓ Y �7 � �;;+ ,'L•J„f•Ir 1 1�1 � ,j f," IIi J�"{.'.7 , ��)' {y Gt'i t �Il,•' r �} r 1>•.` r ' f r ' 4 J.Ir�;% r ,(�♦ , y. , j tl , ,=t, �yrl �r 1 I t 11fJJt :+1/' r + JI'j lrLi Y f ` 't tia�+t�Z 2 MI +• rf 1, �i ++ t � Y J /i , '•_. 11 }' tr 1 , .�f ,�r Ily ` ' r ��•:+ '+ yfl T7 r , ��i��>"r.ttvt +�f r` l' rT :l •r I,71tr`sr rY �I�JI}j i` �'11� ' Y } 1 lr � ,J .�_ {tnw� 1: �,. 1�. I I �, ♦ y. rt .. , 7� � } '\I ,r i *L�i : `i ' T1 ..•1 al t. � � ' 1 11'1'� 1` 1 •1 r I �'i• N� j.• .,[ �tf?�. y,4 .yY�� {li'�%t 4. MA 'r �E'k '<. �� t 4 J. .... ,; �► 'Il , ;./"p'/. � ^-A '��;' ''��;.,' •t N~Y{ 11 ,�y 4! .�,� (y t..,_ i , r'I• ), �'i. t tt`. (' T+la / tii.y � f f ''•R �': • Y r .� :Y a)a .;'..?^+,}► e.;,.1�,- ..., ..l,. iE 1 , . r��! �` tf/��4 �i�' ')i J'• r�•-�� y �.{ ' ,y ley,.. :�+',:i tSc:. � ,. +• r� ,... �� .. `9Y� 1i .. 1,:}, ;:�,�+. ��_' �yt„ !t'.��. Mrs"'`'-y�' ::::::,i;., ...w.-.+�.....+...;:�s.....,,:.'�...+. ......,. _..__.....__._..._,._._......_,.._...._,..,.......••,.L.�....�,r...�.ti.+r:...........•.....5 L..—...«„•....•.1 �Wa:tY. r'� •._ lra,, ,;.:i��r, ).i1 �, r ,r1T'h} ct iit 1' FP,J JOHri CVi4[R S A550fa . • y. 3. 1�86 11108 1)r i y ''•t S - J 1. TITW: ORDERN t O♦ OR-1489088 _ _ ', ` , 1' ^,ail ' d t,..F PARCH NO._ 024- - 0 F �Wit, r A► P• NO. - -10 f,PROJCTs MAIN-PIER RJf)f'sVELOP!1EVT + RWORDI14G REQUESTED BY: HUNTINGTON BEACH REDEVrJ,0PPf` T AGENCY l.�, '� `;�� sty 'L iz MID? HCORDCD NAIL TOt I{WTINGTUN BEACH Rt:i)::VELOPW - IT AMICY 2000 WfAV STREET }Nt1TINGTO14 Af ACf; CA 92648 rRlM RECORDMC REQUESTED Essential to acquisition by CITY OF HUNTING.ON BEACH, CALIFOPNIA Sea GOVt. Code 6103 G1tAt T DEED r A 01, J �'•..� i�fiS tt Ir..fpl (, iY 3 , * L tt r0k A VALUABLE CONSIDEitATION, receipt of which i:a hereby acknowledged ESTATE OF SYLVIA S. SHANDUCK 4, ( TO ' 'AS!' y' I � �• r i �ii�" {' T tA, ! Y.L '�J(i`!r '� 4 t , 4+ 1 I ! It + �r,• It ` r �'• i• t r t � 5 hereby GRANT(S) LO t1,e_ ' ' . t' J`s • r }NfJTDJGTON 11>;AC1I R1�i:V!'1.O1•W.CNT AGl•1JC { A PUBLIC BURY, %RPORATE AND POLI:•.`C, the following described real property in the City of ,,,T; Huntington Beach, Count) of Orange, State of California: i iaj t�t ' lifjti J J � `W�T SEE EXHIBIT "A" ATTACHED IIEj fO AND BY 171IS REFERENCE WIADE A PART HEREOF ' ' I t f r �,.ir + -) r t A�/�I,•llh�� I t�;} f tY AI1. ft � t s Excepxing and reserving all oil, hydrocarbo.t :substances and minerals of every kind �i��{`J��1J� , r�" r :'IN �':rl y , +\t I It''� � 11, � 1f1•�;,.fir j�', i l T '�I�' and character lying more than 500 feet below the surface of said land, together with the riglit: to drill into, through, and to use and occupy all party of said _land ,. �t ►-�., 'lying more than 500 foeL below the surface the.eof .or ;!ny and all purposes incidental to the exploration for and production of oil, Bala, hydrucarhon t r r a a use a ,�,1 t +1' •'t1 �r' ' , itsj' It , subate.nl.aa or roinet•al.r iron said ;lands but without, however, the ribhC to Jet. 1 IL?',i,,jitreither the surCaco of said land or any portion of said land within 500 feet of the surface for airy purpose or purpove:t wluiLsouver• 4 Az +,J 4 J J'•ri'\ L i� ,I i 1 ti j''�rIG1+1' , 41 t tIX 3 ESTATE OF SYLVIA S r SHANDRICK Y�`' Y +►z` ` 1�,� J t i� + •� !!)t.:, ,t.r, w'y �tr: r !1 ,ji r r.. s7 S r Datel � ,,; F%4J., jr, k1•,t'1 , �,. I3Y: - �� {J 41 t`.(t�«(t. 1!' ;ti 4 t t 'yqYJ'•. 1, t4 4'e > r r r4� , !A,•i;t ..v� l !ff t �' �JT�J'r { VJ J� �� 1 t r _`1) ►'' '�li�► J ,f,i C I' '� 11 •'` Ii, .,' tf t^7,' F T 7A;. •t••,,,, } �� ., T✓'r i'Zt a+ S f• `s ' 1, ,, at! �� k> ,r�l:' '� •, +' I�1 t iy {) i ti r, it• r `si ir, 4 State of California 4�V' sa �rfty Cgunty 4f ► t„r,, �i rt 1,r .hi ^�} a� f�•�,Y,'u,+�� "[+( T �f';'"• ! ��rt F ti , •�, s t�,J 7"�i r.�f [ � rR' r:l/� �r(•.1;ip}7(y4, t�i ', r �J 3�� ,,)'yy,��tJ�t ' 1isf,+P On before me the undersi ned ra Notary Public i , a y n and for the State, personally appeared personally , ` known to rue or proved to me on the basis of oatiefectory evidence to be the ; �►jt. 'a� person(s) whose name(sl ..., subscribed to the w.itWn instrument And acknowledged that executed same. a}}/ IaTNESS my hand and official seal. rtall Signature t ►♦END •� V , , xr F!' y, � � i r'1'!f. ,i �.4.,.'' ,. r: .. -Ir , . :. •,_.,,. �•: : + ,.., , ! -,` + 1 ',., r s t. ,i4 �1 � {Ik S,SJ!! � .�• � t 1 � ) ! , ,,, t'r�!', { , r� r4 � , ,i .t iJt3 f l. !{i � =r ' i;., 4 , , P'IItA)I ,.' r, ..!'.k +'••.:' r 1,:" �,�J G r,h::,4y i ! •^ r `,�:I, 1 1:.`:) �'� ,, t�.~ ', !as ��j+t_,f r Jiy1:Jl T t., �llr,lY ,�"11'�� ' { r• r +r Yi•L t..,r ,'t`i .1 ,, , 'l 1! , �t 4 4 7i:• `,.F.� t .,,.r ;y e r I(TI, ;' ,t{. Il, �!"11 r+li;T //,� �/ R ~ 7 i:!t'Jt tiL'}�r��:r't , �• ;! ',r .. : '!:!'•1 ',l f- �f ��. Fr f;. ,� t•. .t Z r rA { �,.+. J �1.it rr t rr? 1 j r ♦ 1J tt• ,r r, t.' ! r Q v• } •rr 7, �r ',�+, ;a,,...: f{ r� ,�j {►i� , t /�.�• '� �'�� r �i `+Ir 'lit ; ,t. ! !.. ,r (fi;j,r�, j ,: ( I; Y' kt�l'J-'�,91JSr�.;,'• 1+'{� +,'T r a {� . :; ..,. . ,., 1 '') ..'�L� r �.L,•il AC!. , i r,';.i .•,r ",ss(( 'f,r'• 1.. ;1.-r t' ;,,[�. 1 :r�' r: ,. �'.+��.a 4,a11't1�flfo. ,,�„11 Y � t ��4�:',:'. ( ,�': ,.r , ;Jr:•i .s '•, 1 '-"�,•t Fr.t:;,.. .t'., r( ! `1!: ' .7af:,�.i. 1, :, ,t ., . ;.�,1 ;,. .21'.�r 't=,•.41t f., rl�, it�'i[r l�i,.. l- y r `r, ':'1 `/ �,,�,� •i'� `'',^ � Ljt',l: i f-{7 i %r .. ... �"'. .!, t 1' �f! .JC. ,,fMir• , 1 � :�� .r,�C,�`a.'N�• ,J4.,ta Tr ,,, � Iz � ,�, .i+,,n; r ^� ? . +� t' J 'J�, ! `•'r J1�t� YN �"jr L.,r'', :1t'L t IA' 'v i " � + •. ., .. E. , '1, zl?h 1 P, , ' r '. t .-k4 .y_ - , • ql4I` gg J } _� �I M 0 ;�h.. r,�1 I I�.�,',I,.,";X.I 1,,:,,�,,;A I�..,,...I;I,"r-�.I 1"�"II.,.1-,.,I W�.�".-�,..,'.1I 1 i.an+ ' •;`. ,-,L,L..,.I.-.1.t�.,,*'."..,,7 f]> �.II.'Ir��.I.I,-I.I:1 i.0 1,.I-.,..,��".,�.;I I�.-",I I,I�,-1.'�,"K'.�,I,i�,'-T;,Ir.,i�,,II1.I0,r.-,.I-i�..,,v,-,-A,,-.,;'-".,M.,�4."I-I,-�1-b,,I,,I.�."I,,.%l..�-I,. t { L".1kt.j-"T;1�,:-,�.iV-.I�1,'kI!I,e�1,...-7,I4I.I L�S41,I(IItjt-i;��,,I�1-,.II I0,),j")t .I,I I I.L!.1I...,Ii�1;i,I,1 t;,1.6..,�..I,.,.1 ',.:O.II!4;,,I.-,I..�-I�.-,',-,F.1I,II-I-rI,1L.r�r1'.'.A.F�I,1'It."V.t..,�.I�,-i..0.,-1X;-."�i?.I��I..-..—�IIII,17.-,-.1"I((.4,r I:�','�-1.t"1I I.O V...II'��,%,,I,1:�..�I1,II,1,�I,,,I. ,,--W,��,N j,"�.,II''�.,1L a%.rII..--I,I-1,,I�Lq4ji.I",.1,,A,--;,,.-�i'%'V.'',',�',,%.,'o.,1;,q I,-.�,G.�',"�:I:,:�;V,�': ,.,,,.,.-.I-..v.-..1I,1l-,',;I,.,,..-,.�.-.-.,�,,',;L'11I".'.1":I,. ,-.i j,.',1'-I.-%.I.-1'".'��1)'�,,',�",.'�I.'.-,;�,"tL1I�.��",,,',',.-A"..e,- ,'.'.:�.,.II&-.'�,-I'�w)",—:4,L�-,.,I,1,I I.��ff..;-,I i.A(,--1.�i j k�t-1 IIII,,-.I I.,i�-,II!,""I,4 I,�f�,,,.-I�;''.,I"I.';...,,,4--I",W.'41 1�"��r�-�'IM";i�,�,,X-I..,-4jI�,1'L:.I,.":II I,-,,�L""4'..-'%1�k..")A�,,.'�-,-,-.-'I,4-N i69V,-.�..I�I�-.II� ,,;.'"-;I'!;,,I,.L.--.-L.I�..*.,.,i',.;.,I,�k,,"-..,i..,j"4I.,�.�)--.I. �-I II�,.�%t,"t;--II-'.:,--I-:!.',,I.,�.��-.f-I'.,I��--.k.,4I,.t,"S"I,�,,0�i-JI-...-.;.r,"-"1I".,-L e,I,,,.I.�",")�".-,.L,-.I�i-'.1�..,,'"I.,In.,-1L'�.-I.�S,.�J-..�I-.,,,'I,:,"-�".�.��,%-1,,.- .'-::,1"-I'�,,%�-i.,'I.I:,,,�,I,L,I.-,';;�.1I.VI 1-1,I,�,�-f�..�,I�,-N:,,-'I�.�IL,,1.,-.-.-,j,',L'-,�;�.-,q).-j��--.,-.i',�,-,--.,�tNj-..,;:,,I,I.,..,,4.;.,I�1,'-,�..,,I.I.��,"3,,,I:-,-,I,--.-.,-I!I.1.,ii,.I;,1,�-,,,..,�,"�,,,.',-�,---�-',.'.�,,;, I.v,,.,,51��-0 4 nj,.4,.,�,,I.,"1�.�'"I.,'---,i,r',,V�Io,,"A-".,1-�i.-,-:,j",�--,,;.,-��-,,,_-,I.'-.-"�-,.t-' �.��I*It��-�1',-,-..-I-�.,1...,,-;L'-PI;I_A;.,_1-----_I,�-.L�,��l4,,I".�4V'I,t,-,.;,.L.�---'�..:',,4�.:.Q�Ik',�,,.�--.j-,l,,I-f_1,��I.�,",�w;"I�...,L"1!-)t..J.-.,..�j�r",...�f""'",�",'1�,",-,:"..,�..,-i%-,,...!..I,,N,,'-L%�1�A..4LI-,�.--,',.:',-0,-"b;.,,;".I,I*".I�-,ji*,I s,.4,1.�tI,-.4,,�,,.-,�1.1..,i—�,I",,,-I.,,'I1'.,,!�,1'.�_,-�%'I'i,�i�-,-'!,"..1.�.�-:.�,-"!l 1,Y.,:',I��%,-.,,',.I,�.1,,,�.-...,".,- --,?L I�I 1,..,,..,:x,-'�I,�,.""1,,.)I..-,I".,,,-�."I,.';,,"'A--�..I�-=r,I,:1I.,,"�4 1 1,.'IJ�I,,.,%;,,,,".-,.,,,�,.-.--,I,,I,.I...,,.,*.1.,..��,1.-,r,1-,,�-,--,Y,.,-%.%..�I'��/��,,.:.,:,,��,,�;l,.I"I--,'.;-(,-.,,�J,.rv,�:.,"A I7..I.1 0,-ko,''t i,.,.4-�",.1-,I,",I.I,.'-.1,��",:"1-,�,'-,--..1 I'-.;,�,.''';-1,,,J,-.'�o�.-IL.,.,1�--�."'..h'o,I-,...�I;1(�%1I.�1!,.-":�,.,I-?.�.,".�. ,,,',-,.1-,�,.�,;!,f i,.I.�I--L-,,."IL..��,.�,"�":1,.-,I,�.1,�.*,I 1I,.I,i-,,I"-�.,,',;"',�.,',.1,t.';.IL-1f1 I7",I,--'r.,",,.,.'�1-"�2,-,i'�".�.I.�,'I,.I.,,,-,i,:,,,,1�,"-�,,�'.�-��-,.I�� "1�,t..t,,�,.q,I I.,Ij�"..,,";.�-,,.I.".,�I-.I,-,,)i,!t..t"�--,�,.,'q I.,%�-".,.I.-�%II:.I--�.'i7�.,,--L.�,.'.,,I"..-,A��;',;�;;i,,%,��.'I.'--I.�;..,,,,",,.-.'jI,....,..,I.1.f,-,%.,.,�,.",��..'j..'-,-�.I�..��—,-�.-7Ir I 1�',�:I.i I."��1 I-�-,,I.,�..,'-.;,-!"I�--�".�,.:"-I).I,!,L.-��.�1 I.,;'.�,��-,"I`�I�.�-1 -,-',.II',�,...,-,�!,I'1'1I��.��.�,..�;.�,.L..I..L1--II I,.,',-,."�lI�z.1-.-'..%',�..�-! �I,.'-.'-,.*P,:I.'��,.''.I�-,4,.I;�,I-IIL 1L,1"II.,,,%1,�-1",,1 I",.4,";,,1�f-�'�-,-'�..�,,��,:.L,-III-.II,,�.j.1'I,,�-,I-,I:'I o I,--,,..-1'�,1�,-�.',-.:,.A,-��,.-O.,.,��!,.';^I1 0 r.%^,"0l,,-.,,.-4.,,I-.'I I,-T,,4,,It,�-f,--�-.��4;0,I"'�.-.-!.��..1,'.-!,-I.-�I.,-X-,1,,.I--,,Ii,,�-)$I-.-.�',,,.',�;1,'.--.,��,.T1,,..-1i,,-.-I.1;.-,-,II,1,,�II.";;,,.',,,r.,*,i. L,,L,-S I 1,,:..j1 n,I:N�Ifi I,;L:.,fI,.I,�a-.,'.�L,1 I�.,-.o 5%'r,4T-,.II'c-;,f&.Wj4�, ,:-,,,i..6.'t.-.��,II,%., w ,,.,.'......--`c,---1 ,I-I�. - �,. r,,,,..,* ,ea,�A ;_�. 1 t.. . ,r..,x, , , :: t' sL _ 4 r �' • 5 i .,.,II �1;---''r1. ,,-,j,I1-,t-,i,1 �-j,-",.%'.l,�i,"-P.,i,�"',I 4,,-.:,4-I..,I"., I, �-"-�,I-,,-� -:.,' 1. ,.,2#, -;I'- 1. ";. 1. (l-!41 �' tilt at ro. r !• , l,,d^kuS '` �, , � - •h%u ^r 4.':::tf.:.•,_,. i'l, i) }-1 v 1.. t, r. •r . "I'i aJli y, ..,,,,41 ...,.t. as ,. t ' ` t " , t 9 --�'--,- ,'1L-.I.�i,G 4-"..f ,-':��.�I.�..',,�".. 1,, I1 I=`:ytr"'Lf .. a.� '11,S 1 /{ �•, t: ~ .5,f: a � h_ "a«� ,G.S`r r'!L::ci„, T� 1' r ;t� f yr.q� ..I,1 4�,..,.�'I it,'..1�,;..,.I�,�i I I,,i,-�.i��,,,,,(I-�',.,'"'�,I-X,--�.,�,I,(I,;I�';...Ld J.,�,;-,"A,1`�'I,.6'��L',�'�,�t",l�I 1,;".,A'"�.:-,,-i.,-,t"r'o""1jI,!i1 4.-�-,Ir,.�I,i.--;',.�,w.-i,,",1,4."-,",-,':",--0.'""r..�::r"I�),I'i'I�,,V;i,-:�-,"1,.,,".,,"1� I�I I",�,.,''',�4 I-I'�1,I..-i;,.,1'.�I,,,*L I��.I,L,r.�1I.I"-".'0.,.r,�LIk,',.-,,.I'.�I,,,-.,6.,�..".�L;�;,'.,I.�;,,$-��.,'�,,L--L;I11L:.�:I I,;'""�.,"-.,,-.I�Ji,J-,�I.,.-kII-LI�r..-I r, ?", .try' .7 f /I. t �' '), t 1 I tr. + Ty, a'1 ( 11,' 1• 1: •i. I {+ -1 r` r ,r;,., _ + PF*a + t✓/� L „[/ ., t r{�1+ 1 ,,l , _ ,r �t. •r ,•1rI .}' ; , ,+rI', , l ) },•, ,v1,�P�,,A,,ii� ,,- ` ' t%-.L. i';` ti ,' l ! .t t,1= r ;r �, .rK ,_!r .., ,I- II iII1'II-1 + "' ;� +). ( I of r+ ri �" ,. 5 ,1 kI :ii ... . •1• ;, , �'.Y.%. .a - ''' 1 r r a� S rt= i�•t il,, t 1 li i . . /, 7 � sr a C M 1 "!1 { : — _ .1 f ��. t ' rr tt " } i. 1 R f''�� p w j .1 #, 1, PI;. '� ' Farm 14A IOdO•t (4/6'( �. ar K Q C A i .y :{I'` " ! H,Ihlb•f A IG PraUm,n�ry F.pan t• �, .. I t 1,t •.1 . r , r i j r5, ail ( j i + ) iAAN�GE�fENT t\: , sr r ;. , a t , S r_ t I1 . t 1 'i 11 J ,t' I" +a Y 1 r �, •, I • t ,� ' •, r r.. �''.. r 1 1 jJl t'_, , j,7 , I (I 1 ,l 1 , , j ? t .F i .,":, ,r Y t 11 { �... ,.' ,) t I.' iII I •y, , I + r / r t IT .t Gt " r t 17 ) , ti .'..} `.a i,;''• tIJP � i. t tt t1 r , ).,. ,�"..i,.�-,,""I,,,,—�A-..,,-,I:,,.',1?.,.,. ,,..,L*"';'F,,, -.."I'�' —1 R', tt ,r,•ti +" �,r��- (/", '�, ,_t��+vr • P-ti'i",' t .'I,�1"��I11,.I,�--.��-I , e1 sr i 1,t1, ® FA -N..',-:,I�.,.,�.,I.,.`.,,-,--I�.."-,,��,�1--...- �I---,�1%t.-- '.,I.,i�"1 .,,,.,1�,t41.1"'�._7 I I.,.)�- .. C,)..*��,-4' "' ♦ } -'}}* y Mks .f;J -.�0,,�."-;,,.;�I-'l,-a;A6,..;�"1-.��A.i-",�.-,t,.",.-,�,-,,,'�,-,�I..,--�,,,"'4,,-,,,-'"',,l,.I-,�1.tj"-:,-Opi,�.Z i.-,-I-I,.,,,-�..,'�,;.4,-..,-",...V.'-i.t1'-i,t.I"'.,.".v'�,..�,;j'�."L 1I;l1r"'I�.,,I;--N�-'.,.,,�I�,'1,,f-�1)1�.-.�"�.�,. �.�,,'.-C 4,":i1"'r.,,-'I�.L*Ltr-��_'�,,.''�11.I,-�.",.'.�,(.t,I,.,'�,I.,1.-,,",-,,�6.--,".,"�.,,,'L,...,,,.k,A1i-.I��6,,L---..,,-.�'..-.,'-.L,�.--.�-,t i�I r.�;.�,�,1,.--.'.-,�,1,1.,',&�..,�,,e�.1,.�'I,-,-,."1,;,-j�-,# � � Y 1r 15t, 1 t+` , tti bL ,�,� y " 1,, v'1 4 :t , ;is it;•(r ` a• I3�'j SP ,'yy11 _ I r ', {++ � I,t7•) � r',.- l)_ �cn,r'r� tea' ! { �P '1'S1, 'l l a,�,ih. , Y f1 y a, A.' t -�,1 1 � , " ' . 1 , .-,,'i L i,. + • J i , 6 t I , + t t p, . r f '+j. ie T 1 ,-,) I'". r� y"t f_, 'I't L 1 1 �. '`Aii " vIJ Tt � � 1yl Y"� _ . _ ,11 t) �wr z' 1 Yt . { + t i R ' ' IX 1 j�( t Y 1'' r J 1 ' .-,,"��,e`..��.,1�I,I.1.. ,1---'??;-I,,.1,�;t. :_.,."�,3�!)I%,�-1L.�-,7 1,t,.i,-t�1.I,�. `f' + ,' ,/ rr1 f 1 a t ``I < rtl o al�,y , 1,r t dv I. 1�;,I I'II---.f�J.,1-7.-.I`6�,I�O.-.,LL.,-"I.I�-..,z):��eO�,�i_ I.0L_,.-.�I�.-.'-,...-.LM-:..t.-"I,.LtI-, ,O�,��I,.,i!1�1 _,�1...tr;.�I'�I.,I,i'.-L.I,#'..i,�1*J 1 ,r1,,'�J--.�-";0:,I.I.11.,-1�I, '4,.--,-.Y�."-,,.�.-1 II,-T;;H,.,--.,�'1.I:*,' �.- ,:-,,i%;I-,�.�,,,,'. ...N%�I.�-Z;w.-,..'I,-1-.1",.I,',I-,,"I' a' rt If,�,rt' , r t ;.I! ,,;Ir;r�j�i;Y 1� L!\k 1;' .',,1'.j'' `f t: t ti.'Tt."r t, It. {y;, Nil.., ' j.-..1-",w--��'t.,,,,.X"1 i�I�,..',t;I.�I-1 o1 I':1i7,.-I.".,.-,',P:,-..�,.1l.-',,.1�-,A-;1l.,-..L-.1_I-I,,.-i-�"'I_,...,�.I�T1,,-.-",t T-:.�,,j.II x{,��r�".AJ"SM1iIr"' �' , ,L I I.1��-.-1 I,.,.",'..I:,,,,'?..,� i„. {'=(It *{e< ,kjt;fIPt�., ttr.4+{' ',•. ail' C,�,'.1-- . ,m...;1 i-",,...�rI,."-..,A' �I1�I If."�1.II�c:*."I1,.'.''-�:'".?I- �I-Z.�,,�v,..�,q.:�1 F;�'"..I..4.i.1I,..'.)",�..r'. . 1; YI a , t 5atr:1 t i}4 r ,1�Sa •,ticl i'1lS t�t.r V, 1, 7 S1 ''^r 4cvl f{ i ti y^u'( +�rri�' \J4Yj5 t'lf-,!t. R.r' 1t '1 , Y 7 .{rr ft},y.I' t+ `•>1 I +�! .,t, • • R 1::`I•.J• {�[,7'•�yt ��'`! ' _^`• I- t `f f r �f t First American T tle Insurance Company ,t ;,R �� "L�;� �Y ., ,,�/1 it ,"l t r. , " k J. ,. T6 y�, CIF " lr t t'R I '. s v s.a I, fr+ I rl' ,t. ,S: r,- ' i,�Cqt Y S"�;; tI -,II.i,7I,.��,-11,,I 1,I,.,�0 11",k-",,1,-�;�.-I-.. 1 'U "I'�il°1.t1' `�•i 1711 i a) 1� - 1,0I ! "Y.t "J ) ,• 5, ,r /'1$ R�r4C P ' i •,in. +' TA lt'- e + t Sf ,) F..f'tl{ 1 .;t(ti'St ti,11 ) 1,I 1 { L rf '+c ' t,ols ,x, ,rFJu ` ',' EXh].kilt: nEn . `~i(''+car +,. y, Kyl. ItM. 't 7 ('.M h�' ' i :41 ! ; .' % . ,11ii, r J } ,.J, , r �.: 4" i f Ir J r,,•'S r ;R 1ra-t'Mt" 1..r' .71. , iZ'%' ', , .YR7>g'C> tt��77o.'[aVfirillt11P1PTI�?SMliibJ,!'►iT+19RWRtITFjLS4 'y Lv.J iR i(fN tl .� *;,5�krL, „.•t7JI .,.I'I.'I(,f�"-�.,,'�,"..'-.-47.,v'1I,1'y.-,I I.I-'..-��.�I.'�;X 4"i"I� j,{� I"HI r. 1. (, '. 1 1 �f , r , v 1 ,5. ,v.,.Z L:. 1, +. 1, i1 y, aj 1, t .". . ". " t J. ,-- ,L"I.I7 I.I.-,I,�,,.'"I;I�i..�,�I:L�L.',,,OII I-II�,..,-..I�1-,-)1.--,I.I-I-.".1i..�-1.R�-..�r.-];s'--�-I.K'-�L-J.�,.1.�;�.I".I, X�-,.....�I.'js-\,�.1..-I.'I 1 4�.��,�1 I L t_A;I,q,1-L.,"-�'M."I L-,-1!r;.�T-.IP-,I1--1.O Ir.1 I M 1..,W,L1.",,,1,,-,�,I-1..,I.1:r,..It--..,�.! I�T.."A,-�".I"I.--',!�.�..I-:'��I.,'�,,-�.�":"'..,I.,IL,'.'-�0.,�..,-,;_I.-J:-.---1.,.I,�""1 II I-.*,o"I,.,(i'-�."-,-jd-V�--,-;.,;I",Ie-.,".'fIL,A-I J.I11 gI"�;"1.I�"jI L'"U,,1I A�.4 i < k {-',W, ",ta, ,,, c t. T t:• 1 L r ,1 ;Ct.L�: . yr ,.'f . .. ,22 i" r:p.;.,.;++J,, tr ,. ,.�{.4.. . ..+, ,.,.:.,t ..'.;.'. ,• , . r ;1<. '' 1r J T !t,<., ., I, ,,:t r .1 tt ,L+•+.C,..aa„ `•�:y, .�);1. 1-.11 ,. .,f,;, i 1i! ly\, 1 N e,�l 1 7 .fl ^y" A�'!.L " fr..,, ,�.:. i+ .; t' :..•:!.• ., 1. ?I ,. , `' 't=• '1` v t .� rr�{, .611,,.._1: , ..:Y. a+' �' h .I M..I�1:,I I.I.,"..,,I-�I\w.I�._"�aI..J'0,..��..,%....,.-.f'-:.-,.�.�..II.-.-II e*I'�I..,�.'-Il�, �+j 1„rr ,1 c Pf.l )1 tr:. r L:'' r:, :. y, •.�• a t('%Lr. .a :,t= i� •i J:•r r f ,('fY,{, '.. v ;...,1 --.r. ... . + .,r. � r• ,: ,1 ,)I .l: ,v," .' •.prs 'I,.k`: 1 5,$ .(` 'J. .t•; ,. ,.V " �•` 41i r �. ,• .. .,...,Z+1'_.., !. • P., -.,. ...�,,... ....." ' + .'; c.�. ��,3'';, t. .li -•i ' f ie rlr .r''+• 1y, 't.;�9' i ..+i• i + ' ;rk{ } + " t; Ij'-j . , c::_I. };., ,., :1.., + 1 1 FS- �� ig , T i.fA, ti. ':X "t t 1- •�, ( ;. "` r 1 t �5 f .,,r!`1Y.,I ) s .;• ,•,.,., ;. ,.... -.,:;a , ..,: , .M ..,} +'�! •�,�'7 ' i 'I.J,., .�1.. ;."l '. .1., l.',•, {,^ .r" } t1'±,i~.I..r. i f. . S. .. �1'' {,{ _ / 1 r T I_.•.;a.,.fir ., ,. 1, t ,X.:%. ,(i' l'I t:i:' a �, , ] r ...f ,.S..+J,S., ;l h. Ir+' r,� f",- 7 r J '1�", 11. I;rlt 13 , ."r. .'r r. rt 4 .:.,; 1 'FI . .r:, .. J t C ,�., W. {;'' 1,, •, 1. 1 y;� as :} `,,,.� 4r .,{.�,-..,,.5}t ;,1 '.t... ..,. �.- .. E,. , ,.. :, ,':.'; '„ - ,x• • (... , �. .. I ;Y„t .,t , •,j ". .:.i�_ `f '�'i ii).'.i{. rf {'iyy,•...•:'•t!.� •F-i-: t?1,','X. ♦: a .,.1t: 1'.l�r.•t >•,,,,.1 ,,- ..1a /T•T. •.�. .t '. ,, r - `4- j' ,, , �t�' �,.+' t. ,�. t Ir, .J / }r, :,..: 11 [ 1 }/p�Jf '.. 1 ii �r it; r; 4 ,'i 2 ss "'S'f.r } !,,k lu, l,,,r� . •• a' - yr-,/';• t 1• ,{�l : �i +i, i�� ,' .J f" 'I '� r 1 ;t+.l t 'I. , ).'. r r #I '.(,.tr1 th*y, + •'s",t�,'�:t l 1, +� , i.;F ?,1 `' •v c1 s `. j � .l "!1 ° :a "'' i1, 'lira 'I '., ) (�. Tr "i I .,, ,}i .ti ('k:}•-r ,1, �,,' I . t : � �.,JyD. . r jj i4, ` ."•)-J,, L 1 t''O1 l_ �..{;: " i It <•., a.' (; ":� +e` ti' t• tlY ,vi K IS t.r. .rr r } It mil` .l(` 1 ' ; •;, , 'fit 04 f ', , f,. '�'ti,'z.eyr •+t 6i i 5,5 •4+ vi 1.11 r`>` :a J ,'Ant r I,: 11; (:, ' �j 1 i• 1 , , "1 _ - ` n f , a 11 - I 1 I, r',k' „, +y itit I}wrt.�..Y4 i '11J 5 ( +:.• 1, 5+,'. { 1. r ,."`.�4�.. t ♦•' ( •t'''Lht rt ) i,{�,f, rS:::1 v'4., fdy. �i y;,JP - 1: ,i ;( t .0 '+ s r ' ,,. t ,1 Y• 1.},+�ti .:,, , � ..,� )Lt'�) V,��tiCI,y t, �� t , ;r,. .: . ie{ 1 ..ei T , .; �r.L'. .. .. 't'" ,; • ' 't.r , .l- 1, :1 ✓ }j �+ It� qtf'=�1�� 4 +' +,it- �,{.. ,..�..,, .� , S �•,, '1;, '.li ',)�- 1 , �'11 •'t j,: �r a 'i.E): , t, I =�i' It a „i� t•r�'.f�jy',1. :. .t ( r ..,. },4 a 1. ! ,� .t,'i�rl ',,;... 1 +1)t.,,.� , f /al f.'r.�� P ::, i,., 1,... XvV1 vlr •@ V 1 � _ ,, �(f ,r��;: tt I 1'J �'M 1} ,�II�r I,f d'� ir'`• '�r`; it• - . ' t �73 +"r r r' .i . r { ,{ l.! i, , t; 11 _ ?1 ,� 11 r 01 �1 i ^`•: J , l „ it.''? �' 7yt "„�..:' 'r5 , �, (!, )r' f.S �� 1?. S n1 r T ,) �' _ l�i L. 1 } 1 �� •r 1`•� A�,= i �., �' ►r �J + ,1 '.d, 1:,f:.,f .�1 1.,�� 1 �,� , +,. r� �. ; '1 ►t�`l, ;q�( F 4'Srj,"•QP �l}.d f• y�. i , • ...': 1.4. ' - ,o �z a}�, t'� ,af ii�' .(� , �, :'' ,..,..r. �-l li 1 ti r t I} '� :� .�;- �t �,w - �r `Ali'%-c� C� r ( t 0 r, _ a .. J. �° ' �' . .., '+ P.,rty i, ,r,1 pt t1 S " . �� ) "I l<,1�.-, 7 ?Y 1�¢l�,�tk.;e: il:- ,4, 'F ' "" ', t` t.� .,,. ;,,ram}` +• ,d: ,�+1 i 1't1 .1 ,}. :?;••!",.1,' •/ • ..•,:; J rvt:,, II L '..yy}, (\ :.�..c :,�' 1 ,•,1.. t r ,t J rJ t I t, I. .. - ._i ,.r'°. 74;',f',4'.�{,,.., 4 !i•r'(� I!.,.. t .1. �• .t ,, / h; d r 1. I P t ;~ d,. ( , +,,, ( k r . cd ,t•.: '-1 ',:' ;;'.• -` 1 ,'''1. .l• 'a e t!5 t 1 i`,��,"��• k " ,... i 1, ;,, ,. • . ;hy :'r'1 ;I,.v,.• .l-+= ,: ? Ir T, { , t t }. �, l r� ,;� t ►� , ,,.;. ':a� 11 :. �2, F :+.t, .r,,, n. .hl, r il...� -.{ (. t fir.., ,;,tl.t. ..�. • `�• i r' .� I� rti '1� {',. g ,,.a. 4 T !." l' t.ir a n. rRt .• !« ,..,.�:: r.•]„ y t �i t ��•r ��, 1Xt'' ] d f U ';4 i.J.{ a ,, ... „ 'l�zt t'+'. ti , �1 5 rt t.r,.L y,l �. }. .'tl., f.J J. , ..u, 7', ,,. 4 .,t-, •...4 rrc ,' ,1�, ,'a 1 •1, .a ,f, ,, �'t c ,-,. +5 '.:�.)�,. . : 3 1 , t 4 I—� . • _ {� s f }, . , rM ( k'i 1 r r. ,�, `, I.r' Its L,. !� S i„ 11. 1 I, I. i, ', I 'id, It :f'•' J I 1{' ,t rl I i �I ! 1 . ,Ilk #r jet If �' , r'J , t 1; i t ;j a r'_., • y, � ��, ,,..;I 1iI�".1,: .�,�.�..%,I I.I*.I,CI I..,�-,1,1,I._, -I.I. ..I..,�ii"�:,;i I.0.�I�II + t , Ic ► I t r� - f, (mil ,i;V i-- ,`,y 11 i.. II i / "f t 4'. ti 4 II • 1 1 1 t,,, t , „ , ,I . ��........,. _..:. t ,._....... ....•�........`..w .1- ,«w.-...��.-.W I«�.fw .1,.:.1. ...,i L`...•�.��-,-,:;L.,. .:t1.K-ri LrialwiM✓] ..-••._ ...�.�..�,--I , , ` ry I 1 j �� r it -rl - �� [ : j- ' 1, a. r 1 ,r` .'i , ,. '.JI. ..•- EXfI18�'Y A at�a r. A, ,,A. : /. .i. 1 ' it LIST OF PRINTED EXCEPTIONS AND EXCLUSIONS (By Policy Type) Ir . `,}1 ", ' , si. rI, ,,., , j! tri"', 1. CALIFORNIA LAND TITLE.ASSOCIATION STANDARD COVERAGE POLICY•1973 , , I- '" .r� ; i,( SCHEDULE U t� )1, ' 4f,[; . , I.. 1il, 1 A i ' ,',1 gollcy 4oaa not resting afpslnat lass qr damage,,,or apoinz♦1 ec+sts,altarneys'laea ur erpe nsaa any or all of which anae by raglan el the lallowlnp; ;,, 1 1 _' , 1 i 11: , ti r i`rt �1x■S or asteslimor s which are not shown as existing liana by the records of any taxing authority that levies taxis c'sasssmmevlls on real prop4m)Or by the - i,v( t, '.' � CubliC recordl I 1 i,L ;' f if , 'PraceaditlgSUyapubllcsyencywhl:hmayresultinlaxesorassoisments,ornoticeaofsuchProceedings,wholiveratmotihownbytherecordsofsuChapaacya.)y 1,4.. ,ti; ia11 . the pubic racordr. r , t,1 i,a'' I - I1, `- Any facts.rights,Interest a ofClalmswhicharenotshownbylhanublicrocardsbutwh,chCouldhsafconalnodbyaninepactionwlIhelandr+rby.nakinptnquiryolper a, ,' ' t i , lot.I in possession thereof. I �' 1 Easemgnts.thins or ancumbrancot.Or Claims IharoOI.which ate not Lhawn by the public records , 1 't;/'r ! '^r ,, I C .crerianclas,conllialsinboundaryMon.ShortageInaroaent:ioachrtents.oranyotharfactswhkhacorreclsuneywoulddisclose.anilwhicharenotshawnbythe t` 'aI ;' �, I- `Y! ' Jai`I Invalanled mining claims; (bl reservations or sitceptbne in patents or In Acts authorizing the issuance thereof; (c) water ri;,hls claims ar lttla to avatar, , C. , �A' . 1 . .; ithelher or not the matters excepted under(el.(bl.at(c)era Shown by the public records t, ., t t ;� i Any right,Jule,imUuaL sststs or casement In land beyond the Imes of the area ipedlt':aly desaibed or referred to In 9rhedulr A.or in ebutang ttwsts,roads, 1, �'.' 11 i j' ,�' ' ,,I aysnuos,allets.linos,wayacrwalerways,twtnothingInthlrparagraphShelfmodifyarl;miitheeatenitawolchthoordlnarytlphtolanabuttin'rawnerlataccasstoa ¢ t t4+ 1 Ir, �. , 11 '' -I ) physically open street or highway Is Insured by this policy. `t!_ #, "f I A f� i Y g ( p g g 0 ncl:�sa it#,�,.!„ 11 i ``I c An law,ordinancdorgovemmentalre regulation Includlruttn but and ordinancaa)restrictin or regulating lhicccupa } ,zt). , 7 : i I or enjoyment of the land at ragulaling the chathester,dimensions at location of anyimprovem:eni rower hereslt-dr erected on the land a prohibiting a sepuallrn in " 1 4 r ; `i' ownerahl at a change in the dimemContorateaatthelandoranyparcelofwhichthelarvaIsorwaaapart,+vhetharornotshownbythepublicrociidsatpolaofPolicy. rr `1' , " , "' i i "I or the eflact of any violation of any each law,ordinance at governmental regulstion,whether at not Shawn by Ilia public recce at Date of Policy. ti-&irt) . 7` + Rights of eminent domain or governmental tights of police power uniaaa notice of the exercise al such rights appsllra Ir,the bublxe records, �r, I �,�r, "� ;,' Defacte,liens,encumbrances,adverse claims,or other matters (a) whether of not shown by the public tet.a!do at date of policy,but Created caused.SuHarsd 1. :. .`. ' ,, assumed or agreed to by the insurers cfatmsnt; (b) not rhown by the public retards and not otherwise excluded:tacit ct�versgs but known to the Insured claimant 11 ��`r"•I } I " t r._!t T; I ;t hfnaraldateofPolicyora!th.datesuchclaimantacquiredanestataorIntorealInsuredfythispollcyuracquiredthelaeuredmortgagoandnotdisclosedinwriting q ;'• - ;, 1�' ": L, , �:y the insured claimant to the Company War to the dale such Insured claimant became.n Insured hereunder, (c) resulting In no loss or damage to the insured 1 v,` { i '.` I :!aimsnt; (a) alto!hingorcreated subsequent to Date atPollcy;or (e) resulting+nlossofdamapewhichwouldnothovebeenauntsingdIttheInsuredCIAImsnthad 't171 t f �' .�, Ij �i,, +:. I} ream.i purct.sow t encumbrancer foI value without knowledge. r,, 1 1 ' t 1 • ,k + I t 2. AMERICAN L�NDTITLEASSOCIATION OWNER'S POLICY FO3M 0- 1970(AmENDIED 10.11.701 t;�W ��' 'III lye :�0. I ,,m ' J:1 SCHEDULE OF EXCLUSIONS FROM COVERAGE -,-I,".. ` ' }p+,'rt,;, ,+t " I f 1` r,:, ti... + 1 Any law,ordinanceorg ova to mental rug ulation(Inciudlng but notllmitndtabulliling and toning ordinances)restricting orregulalingor prohibiting the occupancy.use + I, �f;1 1.!% ':I .1 Ofam(oymantOfthsland,of regulating the character.Cmansio,isort-3callunofanylmprovemantnoworherealloterectadanthalandaprohibitings%operationIn 4;r!t' yl, ;f �ti�� 'r / ! ';i�s Owletahlp ar a/edl'Lylgn In the dimenrbns of area of the isnd.or Ilia effect of any ablation o1 any aw;h law,ordinance at governmanta:regulation . ' `` ° ,lights of eminent demalm or governmental lights of police power unless nullce of the exercise of much rights appears In the public fecords at Date of Policy, r 1 ,117;4l�1. 'i f I ar a ar, �' }I ,� ' . I, Deloots.Ilene,oncur branceaedverseclaims.arotharmatters (a) clealadsuffersetssturnedaagreadlobylhoInsu►edclaimant; (b) not known tolMG,mpany �$ .•`I 1C j �`J I ", I; and notsbtrwnbylhspublicrecordsbutknowntotheInsuredclaimanteitheratDateolPoikyorAtthedalesuchclaimantacituiredonestateofInteralbythlspolity .# .� ' r(.,': :l Il I ,)cr, ' _ r1 .$'' ',., and not disclosedlnwrilingbytheInsuredclaimanttotheCompanypriortoI"dalesuchInsuredClaimantbecameanInsuredhisrsunder, " i ,((q resut,lnpinnototsor { t , t' I ° 'tat,1 I" , 11 Ir "-I damage lathe Insured claimant; (d) attaching or created subsagt:arl to Date of Palle,a (a) resulting In loss at d+tmag*which vrnuld not have boom sustained It ,' ., j , � ), I �� Ir i;1 the insafaa claimant lied paid value for the estafe or Ir+terat Insured by this poP,cy, I Jyi .',;i 1. sat!/ , /;, ,, , 1`•.I }t1 r ,,,,r I: ' '{f. i .. { ;.+ 3. AM!^RICAN LAND TITLE ASSOCIATION OWNER'S POLICE FORM Il• 1 ti70(AMENDED 10.17.70j +' 1 r` ) ,, I . ,. 1 ,. ti I i , i- IC;Lw` S�1',` r , WITH REGIONAL EXCEPTIONS ,,; (" y, ?(,(.,, , 41 rl. ) 1 ( , t ` ' 1f1 ` , knlheAmariunlandTilUAssxiaflonpOlJ�rlaueedasaSlanllardCovsrapsPollCyandnatasanExtendedCnvsrspuPolfcythsexdwbusxatfuthfnpsragrsph: '; �'� > }t[i "C�� + I ve are used and the following exceptions to covotege appear In the policy. ,� t' ' 'A I":�',it�i , 19'Y «, , i ,Ice, t 0,r,' SCHEDULE 13 l% fiti� `r 'I+ r " `; 1 ' ,F t ;i t� s policy does mat insure speinst less or dsmapa 5y rasson tit tr+e mature aho+vn in pans ate and two fo awing_ t, I ,t, l� IY 1 } :r .t t j tf_ 1� ,I�/. ,I �t r: One. `��IJ ' i.SL t;. 1. !�11 '!' 4.' � ✓r��i'7 1` , ` Tuxes or assessments which are not shown as existing liens by the records of any taxing authority that levies taxes or assessrnenls an roil propeny or by the r � t' , 1 _ i } f tin! r '' r ::' #, public re Cord& t t/, r r i ,h r 1� / 1 l I,, t i AnylecttrlgattIrilvesta.ofclaimswhlcharenotshownbythepublicrecordsbutwhichcouldbeascertainedbyanInspectionofsaidlandorbymakingItquiryclper I ^ r rr; , . 1 r - ' .' '� .'I some in Possession thereof. l •.�, •I r �� , �'f `, , ,,f `;: I, ESasmenl&claims of easement a. encumbrances which&a not shown by the public records. , I J Ji r, 1 .', r � i fit . r'i, , *rt �� Qlacrepancisr„conflictslnboundarylines.shortnpaInstar,encroachments,aranyotherfactswhich4Call3Urasywoulddisclose.andwhichamrialShown ,' )�� I, �y(, t i{( j '' 1. iyi Ill ,r ,Ic,rt' r , , _� pubilY:raxords. 1,,t t«I 1, + It�' t , ';ft 11' tI. }r.,� Unpatented mining claims;reservations or exceptions In patrints or in Acts authorizing the Issuance thereof.water rights,rfalms or title 1a water. 1' ''1 ,r!_:.'t , •I1- f' �I pf f�14 I t, Any lien,or tight io a Ilan for services,labor or metild"I t+aretalara or haraaltet furnished.impx;snd by law am9 not shown by the Pt;bl.Ic records Sz a •I; t iffy► ( r " Jt 'L,rI.i t •,�yT 1 i _ r� 1•;t` ,ISy�C�7►rl.t'r rl, �. r $'IlrZ t� 1 111'1, ! ' I, 'i:i 1 7,•t �. `I I'i ti' rf: 1 r t t i'J .. .�} 1/ ,L' r l-7' S, ,I ( ij1 1 t je', , t ,a i ., ,r ,* i f tty111ii «f ,r ,.1�/. . y ft r t�l ( .i ♦ 1.,, ti.I., , 1� , 'T { 't «its .IN I�.'*.;t 1 1+ ,�i,',.i{+ V! r" )%�t j,�;. I i L ti` ` tt)�,•i�T`r /i�, !-. ire.:P'�? .. -,,_.,•. ....• i�4L2111 4 Il,i1 1r•, t! r +-tt '. / #�rt�'1• 11Y w��. �. ....� —�� r..•. ..., �........ ,• . iJ • f { ! 1,.�:U'. lk.1,`.'' ., 3l i"-'.ts' 'I `-. 1.. r. - /t .,. ,! i" :J tjy a ti }} t 14 , _Ii, :•,k�1 { ., t} }# •f r •• „i ,I _ -. 'r,4 1t !` 11 ,I ,•� ' ,I ; �, , � li ST, r2ff•': 1 i r ,r ;� t� f,z"v �I { I I• t tp`'ti; 'ti J ti .�f} .i, 1 .I t, 1: ,. I ) f,1, �S `q.I j .s. , J. #`• lr:,Y1 i ,.' ,i:':t ;..,t ::;Ii, l:• ,l. . I. .1. r �i, L ,:l .r , a hl. tf .. H •%'_. ,1 ,; . ,i r.ti f 1 :,I:u, .tl `f I. CI 6. t . y.1.,..,1y. ::,*./'•'.�..ia.l-�•,. ,_.•r,: •. ii.,..,• - , C. iii' i ii.r .r i•F «, -: Y„//, .,,i.�, 1. ,.\. , ..!:- '!' -, , I 1 '/� t1' �4 1. t t" '1'�. ,{, rh, ^,:. .t iy4,.j�•" I ' '�':.;(i ii �.t.ti.: , 'S:i ,;' ice•• - ,P .. �I- , +r ✓� irt. l>�.a1 . .� „ .-. + ;�, [+. _;. r. .,..y f!t:.':1 ',, , '(:�:i- •?t.,. / �«k ,i' 1 •t •, , ,:r. Ir •ll.. ).•1''�I r f�,.: .. ,t,"J _., , , •, •, ',1 1 I ``7.1i y J' }� ti:' :I �• 4.,t;. i i " 3 tr! 1,:.•� _,.`'L+i i # r .� L' tl (� Y' kS��. ,r C, ` 1 :1 t rtsprr<, •,.«,/ 1,..�. =� ':: •':'t.':, '�.:, , • , ti, •L •'.": f i,•{, (1* i't ,i l.:,r'• :, i•+ r r 1 :.cis ' y •17•�:•; ;,,I 1- 4r i 1'' 'f: . <y ,ff,, ..4', • t , , ti t �1.. •.:i:��'t¢i J/rru, d{{., 2 „ (1•I,, _ ,I.,: •, ;1'.,'j , -'j ",t t :.r :i l,t I:i'� �;t7 I. t.. 7Y LJ ..I,,. ,,r X ., ... r, ,. r1 ,�. r, tit ` f I .+t S;^ °,�f,, .l'• y," '..rTyyct_ 1 ,•t1 F-1 f ! „,t• 1' :r+. I ,., \.` 1 dS `1S ', ;1'fiZ•I LF i.'f.% i., �i 1. l A r : r, , , ti.,u •.< ., i • ,,v)., is,:;' .. .1i + 1 , , •I,j,,i, ..,�J:(!f1 j - t� ,; l3L q �. �� t �r t ' , .rr,, t:.,,.«;!J•, .:,,r 1 •. _1.� �i 1 r , '�. f 1, � `1_ T Y t.- •�._.,. � ,,1,1. 9 . : ,J .t ..{:., . . , i. i„r '•..41 ,(-.-''t.. 'i ir, ,,,.,^ , ., .f[i ,r' ''i r', ,� , �,. �f y.l h'4,„- J i. .:«+' i' 1!..r„ �: f' r \fi-1 , l..1 .<.:..: •, •.r , 1. 1 `, ,, lit �I, ; •1,1 l t ,) il �.jl 11 } 1. ij' ".0 � r 4f ;,r, r, j,I,r •,:,l,r, / +.. «'; 1 l< Jlr 1 # r %r, a r,� ,, .,. .,t i,.. . ., .1 t 1. .11 .�. . «, .;..,.. ,:+:.._, ,'' ',1. . .- •�: + 1 .'r •I •t dry ,, , r /} [[ l Ik• ....-,...(.: '- .. ;-,;l '.,I ",n. ... . t. -. I 1.. 11 /f4 TillI 1 f,',. � . t _ ii 14 A,+; y) ,,,1 . . ,, 1 t 11• y: f) f.L � i(1.. 1k !/ICI t'LIf- •.,1 t< .n'.:(r rf: ,.. .J, ,•.,. ..,'' t, I 1 iS t,l. >rn r: 1 •I 4, „��`� it 1 ! ` t • cl 1'i �` !£ Is lgrltA 1,i, r. ft' r , t+ A+ t «1' t. I ,+ I1: rl�s,.,Lill .1+ t� `ij: y r1,'I''•, I•tC'r1 -i b,-I ^r1 ,}.. I i f I'.'�''' '• ' - ' ,. `I� - - . I.. ��r1 Il ." .•L w iy 1� . . :{ ,' t ;jr It .1 . . : : , , _ , ;, ;� ,r ._ , - . i , I I� . I -� �- I .,�7-��, . , . . _, . T' ', 1♦1 t F__ I..l r . 1. �,,�:I . I � , ",'. - . , I I I � I I � I I I., I-� -�' '. .I � I. :%, ,. �.� } , f � I . ;}'. , •;fir . '., . I �I Y : - Y , ,.1. .I I .� , ; I �'j�r,� , , ., I , I ,I ,, - I �, , ,. ,.11 ;"�"�"� I . .� �� , i i I +, ?}1!{.,�"tit , '. ! ,, I . . ,i; i�1 l i,'el, I . . : ,. � I."�'i ".., I� . I !, ,- ,- , �� ,,I , "( . I . .. I . ,. ,: ..', 7.,, � -J) 1:�I, 't , --�4,1 ,,t , , I I . I I I . � I I. , �, , , , I. , I . � I , . I � I I I I I I I ; ". 1,..:11 '- i: � . I I I 1 I ,.11 I I � 11 ,,-.. I I I I . I r .tic11-,.- .'to , .- ,}) ..:1 , 1 ! •, I I 1 I ,. 1, ,,',I, -. , �. I; �I t ,, ", I I. � I. ; I I� �� . I ,i - . , ,, I I I .114 1 , ,,� .., '.1` , �I" '. .�1 1, �4, . :. 7 1. I � ,. , : .,� I ! , . t�, , , . .I � . I � I 1 . . .I . I I I, . ,I �. _.' I I I I .I ;; �... , , .I �I.I. �. ,I �---I I � f II . �,, � ."r� I "I,.,, ,1� ; I I. I . I�,I � I�,I � . i.1 . l I i � �1 4 1 � �'I . , I I I ! - '..,,It l ., f,,,-" "�.r�,,I i,��-I, .�` .,<7 1 � ,, t � . � . .11% � ,. " , -� . I i 1,, -, I . .. .,i:-,, ,, I : "i r,-) \2o"�� .I ,I � ., . - I . , �- ,� , , , ,,. . , , ! , �r_�:..,,. �' • , ., . . 1 I I .1. % I � ••. ..� 4, �.,,% I 1 : I � :1 I ,I. I - , - I , .: I J . ,,,, ,� .:,�" I I r " ,� . ,, ,..1 I .I.I1� . ;) t , .�I�1';I' �., , . f I 1 .,�l I., I ,I S I",�I ,L, , q , %I 1. - _,.7�jj� •V1, ,1: - if . .. , Iw...,. _._..-.r.._...a.lt ._c . ,,,f .i'l,•, .,,.. ...:r,r ,4.., . I.I;,.I- ..>L . ,.r, . t.. . ..:.1�1 .-.... ._ ii.. ...r..�i:?r'•`i i-•..•:. >. , • ..... �..... r.r w4 n.�sV4eN,ILJN L l l ti ,i, i VAN POLICY ID70 , t� ' ';' { it WITHA.L+T`•"'7WDONSEMENTFOn11111CGVFnAGEIAFN�t2D1t3•t7.7G) % ,T :. r t.ti .11 ''I {i '' JCNEDULk OF EXCLUSIONS FR OM COVERAGE 'rr' a �;.; •r ' r Iji ' 1 , 1 Myt�.: :,dlnaneeorgwernmentalrepo!atldn(IncLtd,Mbutno111Mitedlobulkfingandzoningordinancaa)roNricUngorrepulatingorprontbttir)glheoceupancy,uae' 1 t. ,, v' " I r'I3,{- „ or Ten+011hetar,dorrepulaunp6eecharacter.dimeneansatloetlianofanyir•Frovamenlnoworhereafterlotmiedanlhel:nQorprohtbillnq.�leparalion t -tr ' t1;, �' ) Ownersnlp Lt a reduction In'he dlmenaidns or ards of lite Iona or the effect of any violation of any Such law,ordlnancs at govarnmanti+l regl,lNbn +, ,t. , I•' 2h11 of emrnenl dome{n 0► overnmenUl r hie or' i. g ig pOI1Ce pOwr7 unhrsa Holies of the exercise of such nphla appely In the public records at Dole of Policy,�1•f �.'KQ,T� lecta lit nl rncymbrat►Ce>,adveroeclelme,orulhatmallere tU cestadw!f�edauumndaapreadlobytMtnaursONriMenl; (b) nOtknown101h t, , I', tI C, `- I l y' _ and not shown by the public:acord.but known to Ica Inslrndctaimant either at Date of Policy at al the date such cla,msnl Acquired an dials Or inlerrtle insured ed Dy ,1 t r; r Ih,spohcyoracgwedlhe'nsuradmollgapeandnoldlsclosodlnwrdlrfgUylhe,neuredclalmrmf101neCompanyprW►tolhedltnwchinsuedeirimentt»camean , 1; I. ' t t ,naurellhereunder, (e1 test,,inginnobsaordemapelolheitsurndClrlmant, Idl atlachi.igloo►eatedSubsequenitoOilsofPOkl(iuxcepttolheextentonaurar,ce c_Vi t f r' 1 isaflcrdedherelnasteznyatatuloty:lenforlaborormaUftala,IdtheextantinsuranceisafforoidherolnaslotaaeasmenUloruraelimlxoven.anlsu.:dHConeln�c• it 1i .; , I , • ,, lion or completed at Dr{�e of Policy!, 11 t " ,.- ,i-I!1 a• Unenforcstab,lityofthelienOfIn8I'lcuredmortpaDebecauseOflaaureatlhainsured+ttDatcofPolicyorcfanysubsequentownerattheindebladnesstocnmpl will, :+ ``f, + I :!1 I I. ; . j ;,i-1,`` a0011C3ble-doing business•Irws of the state m which the land is Violated y , P. r.r:,, i h;r ' i7 t, ;r ,, , ` ,' S. AMERICAN LAND TITLE ASSOCIATION LOAN POLICY- 1970(AMENDED 10.1T•70) ' '$ .f. " r WITH nEGIONAL EXCEPTIONS J t';t I, ;1 rl' `.) tt, 1 i When the Arnarican Land Tills Association Lenders Polley Is used es s Standard Coverage Polley and not as an Estended Covuege Policy,the exclusions eel for In '' i, :% paragraph a above are used and the following exceptions 10 coverage appear in the policy. J•t ;, +t j �, It f1 �`i• t •1 r 1 SCHEDULED i ; + This Palley does not insure agsi►.sl loss or damage by reason of the mr,llers shown In Paris one and two followinD ., ,�} . 1. r I ;' Part One: ? :, t I '. 1 ,+ t i l' t. Yanea ar xeaelemdnla which are not shown es exlsling Ilene by the records of any fixing aulhonly Thal teulea lexea or aseeiamen:s on rail• Jy i ` :+t f R?obony or by the ' • ' �': !st public records �� 3 ��l :,t r l� �/yt$; .r, , l 2 Myfacis,HDltAlnlersala,orclalmewl,!charanolshownbythopubllcrecordabulwhlchcouldboaeCertslnedbysnlosped no uldlcnQarb maWn I , c 1 ,Ytf(�[tI'll 1t r. '1' . If41 ,st * F GoneinFosSsulonlheraof. i4 ,�� Y p nqul.ydfpar• , r6. t1 11 �. Essemenis,claims of eelament or oncurrbrancoa which are not Shown by the publlr,tocords. t n{ 1. `i " t ;'. 4, Olacrapaneteeconlllctalnbcrundoryllnes,ahortagelnarea,encrd,chmonls,oranyalherlacfswhkhaearreetswveywoulddlselose,andwhkhuanorshawnb I ',I/ ° t ^e.•. t pubi C retXttd� Y , t !! ,t� , 1 }' t�tttf1, s, 't ? ) „ , 1`. 5. Unpatented mining claims;reservetlona Or exceptions In Patel-in or In Acts authorizing the ieauance thereof;waist rghts,claims or Ilbe to water. F '+ �f, k? y, ;+, ' �"� i' q. An 11e or tight to a Ise for service;labor dr mnlerlal Iheretglon or heraafler(urnlahe Imposed p Y rti b n �' a' 1 ` t d posed by saw and not ahOwr. i , nnt. , by the publlo rseorda ,< +.Z j, t; ai11 ci s i�ri ill ' 4 I• ,i 'LI ': ; ' •-.' `/'�' G. AMEHICANLANDTIYLlIA83OCIATIONLOANPOLICY•1Q0� ' r „ t @ aL 1,_ ds.'fit t, r WITH A.L.T.A. BMDOnSiMFNT FORIA 1 COVERAGE 1818'') t >� 't ,f I,I, r- i , , r,.` a� 1 ,., }. r ! I t�� r . EXCLUSIONS FROM COVERAGE ! J, �i i 1 , 1 `I J ;r1 rho followingmatten111MVPlesslyexcludedfromthecoverageoflhIspolicyandtheCompr;nywillnolps lassotdam■ t 1A. '', , Jw �; I.. by reason of- y Da,Cdsla,slltxneye'Iseaoraxpansaawhkharl�a J,. a;, `; ti t, (s) Mylaw,ordinancsorgovsmrneutalrepo!albnpndudlnpbGlnett!mflodlobelidlnpar,dzoningfaws,otdlnancal.orr ulrtbnalrsatrklln r u1a11 Injorralaiingto (t) :heoccupan ,uaat,oren o p a rep n,),prohibit• i.; I ' n ► YmanloftMtand; (IQ thecharecter,dtmerutomortocattonalanyl,nproverntnlnuvvorhereaftarencled Illon �t`r�f' r ��, I. �• "ir thalana 110 saspurllonInOwnershipor@changelnthedimensionsorseeofthelandOran r_ +`1. ;, r' ptefectlort,orthvefhrclofarryrblallSnellhares!Seer!,0rclrneneeeorgovvmmsntslrequl.rtlons,a cepftfothelsshenitha�Irol�oflheelnf (� elrlrofuaental t �;i; r�, 'I4 rir t; talrCsoladalsct,IfenorenrJmbrancerosutllnpfrmstiiolallonorallogedvlotatlonslfedlrvglhelandhaetseenroeoreladlnlhapublf0rsc0deatDsleOlpacement ors i,- �r' ' �.tt , u Sri f !' (W Mypovernmenlalpolkepowsrnctexrhrr!_dby (y ebove�eJtcapttotheextsn11hd1aratko011:gee �rdaetheredorsnolkeOladelacLlienorencumbrarue ,trt ,1, P, . Ff r _ t ,1. reeulllnq frwn s rblalbn or aiieped itofaUon 0�leCt'np the lard hu been recorded in Iha public recotda et Oals d Polity 1 /' ` '','J,I, a "' ' ,I i ,, r= . 2. , RightsofeminenldOMLlntlnlsssnollcr,•J1hGexerc!relheroofhatlbeenfecerdadInthePuWfctocordssit0aldofPolicy,butnotexctudingfromdovorageanytakinp � � J t +j I f` r q ►r fl�l' ;) '" ' 1 1 '(i which has occurred p•lor lO Data of P•Atey which w3uh!be bindl�0 on the rights of r purchaser foryalus without knowledge, 1`;i S Np Y:y+ `,x t M t� ,t ,° `, t t} J. Defects,II'tna encumbrances,adveres clalme or other mrltm: ,s l ,, 1 ., i tt, J (a) rteatexfr aulferelL assumed or agreed to by the Inaured claimant; fr '• p " ' (b) not knownlolheCompany,nOtrecordedlnthrpublictacoldsatDalsolPolicy,butknrtwntolhelnsuredclafnantandnetdisclosedInwrillngtotheCompanyby rf�r ,� .,>! ;. ),' ;.., C t � �' y r z r the If•sured Claimant prior to the date the Insided claimant became an Mauled r Eder Ihle policy, ,� r �4' }Y , r ,, (C) resulting In n0 bu or damage to the Insured dalmrnf; r �,;, ', rt• , YI I �t 1�; (d) ailecho+porcrealedeubdepusitit toDrtedPolky(excagttothesxtanllhallhlspellcylnsureslheprlairyo>fhallSnellheinsuradmalpegaoreranyc.atut0r� , f ' " rt _ r N 1. lion farurvkas,IaborormalaHNorlhaaxl ant Insolence iseflordadherNnnetoeudssmanla lot atreel Improvements under conslructlonortomplrtedaldale -l<< v1 �rrt "It '; Jjv 1 i, t )�+t1 / C ;'J I^a tlit of Policy):et r '' 1 V4 ,- (a! resulting In toss of damage which would not have bees sustlinad If the Insured Claimant had paid value for the Insured mortDage . , + .r .. _N' rI r I \,' . �I r ' '1 ' t ;I �?),�' a. UnenforcesbilityclthelionoftheInsuredmortgagabecauseo:IheInabilityurfsllureoftheInsuredat0atuofPolky,atthelntic, siluranFsnysr•Dsaquentowner r�`i1 '{ ,.1r+ .?'t` . l 11 t ! , ,i '.. I ti Ir of the lnaablednass,l0 Comply with 0olkebig doing 5tJamaas lawa of the state In which Iha land Iu sltuelad f :; i t .{.' }, 4 �` Ci'I.+ ., 4 ' ,, . i. InwttdllynranenfacubluryCltheNanolfhelnsundmortgage,prdaltnthareof,wnt.harisasautofllsetnr.sactionevldanCed!rytfwlnauredmoApaQeandisbasoA r ';rJ' ,,,_'ti ,~1t} _ 1 y / often ururr a enyeonwms:cedll proletr.lon or Truth In lending saw. R r 1 ) 4 ,. '' 1 1'irr� ) 44 Ar)yalatulrryltenforRervice�laborormafartals(wlheelsimOlprioHhtofanyaUlLtoryllenforsenrices,taborormaleHehoyeflne:!rnoftM)n r41 �r Jir ,`.: tmenlmprwementorworkrelaUdtolhalandwhkhlscontrnctardfdrandcommancedw[e sunftnortgagNaHs• x -, t ' 1 j I}11 y 0f the Indebtednear secured try the Inaured a+oApape Irhlch at Oate of Policy the Insurt�hrstadvenked or b Obligated fn sdvendcR whole •t bylxa > ' ,, '( 1,-d ! 7. AMERICAN LAND TITLEASSOCIATiON LOAN POLICY. 1887 wan r �I k ,'., 1�, r 1. �Uhl , f T Tl� I 1 ' I�ST {yt WITH REOIOaIAI.EXCEPTION$ r W. � r M' r+ I f , l % , f Ir J i `' IL `J t r`i 1 n� f't', nenlheAmerrcalnLand�itleASSOCIatlonpolteylawedaaaSlandardCOven repel J t I �I , .,ui }; t i: ,t r '' r _ t>a s ar1 wed and the fodowtnp szaptbns to raversgr appear Gn lha g end not as an 6atende7 Covernga Pe.'Cy the sadwlona sat forth In patgtsph Q rl,l ( t rr •' I,I ,:. ,1 pdlcy, )l it. ', k ` jt Q-, _ t .: 1 7� J i ' 1,` .1 r� "�.' i t.'jy) •{ _ ): /t rt.,••. K,t'•• �'.q, r. ,.zs. ...". ., (continued n•n w,r- -.�••, .f,r r? ' ', !t•4 :tS,,+t aI �.1 1 ii d an bat r. 't, ,Z, r :,'.:, • I 7 .t , (..n>r-t 1, )�.". ,S r. _ ,. ..,: j.,- -,., J., r,n.r p.�l..;...• S ' •Tw ,I 1 ca us 1 ,.:; .:,J.+i, '.•`,�� } ;, i i ."1. 1 r,: 1 ;� n J� _;1 f, ,1 S t- Sic , a'r �. , ,,4. 5 !;. w ZJ, 4^ , r Jr i' _ r ! r�r�,. j{ .,. ,.. c " I ,I • _i..,, ,,,.-,,'.•'1,.' .. •(Ji+� G" -�,^ :,+•��. rk��i:, .,� -AJ (hy �f Jr ;i� ,.� JJ -S.,:Lr.,l 14r,,. - r. tl , { �1.��:} •rr'r,4yi�.f2,1f1. � J „�;wr•,�1,.�.,I ",.. •-{ ,.' , _t' Ir�,,. ,•.}-.; .', -. :.::.i•I,' 1. . - , , 1� by ` ' I ,'f+.I,L.. '', :-f"�"'� a?7 . .,. .,,ICY.. t ) t„ n', , t ; t, , ;,. .. , t t,:7 ;. ; t "►, s q� «.. l �C } l• 1 It ., :l�) :r , : : i I, 1 1, rrC'i, ,. - `'I •r, ,r ...:ail ql :• ii.., " ' . '"" ii. r i r.s.r / .)rt 'tF7 : , ,: :!. t''• IM't !.. /r.% /•. 1' ! I, It �I 1I ;4, l• r, J Y, '; 1 }•5,,)R.. - r it : ^r.:��. :; ,// , ., '1 ,,, .....: ,'., ._` .. ,` ,•t� ./ , % '��}1 , '' -'I.1 ... 4,', , �..•.•, ,-i, •. , r.. . �1, y i` ,, ,I. :i 11 , l' ,). 4. 1, 1.1,. .,..,.. ... , -,,,. ,,. .., • '' .. (l , Jt•',J, 1 LZr '1 `''I1f a { .,: t ti. :.!- iJ', �'rt7: ;. , , .!', - ':., ,/. i. Y .6 / ':ir.5, ,.rf-'r ,.., �'t >.� ,r .1 ♦. ., :. t1 r.e ..•:. , + r r' 1,[° 1. a ,v :r. !r 71.I. • - i r ..l..,•: •• t \ I. i ft / ,, 4.}� ,_ ,- ,,,. t. �). , r, , IJN'?:a:, J,. tr, ..;,`:r' 1W1,,,).. ,.;?tom t ;r'. ..'i ,,i: J 1, i 3,� i; f1'.' 4', Z x yr• �� ,,,,, � t, . .J r ,• I,. LI ,,e :. .:k,.., :..:. ,I ",ay.. ., L -r. ., `t- 1 , 'r 1:�}f '7 r;'t' „ ! r J { 1' `t .,, t....}.y}' M.'At,,,S•.. ,, , '.`•.,• r 7'.Ir,' ,.1.,.9Y ,. 1 :i.,. , ,/` J. I: tilt; y.,;,.. .,i';'�'F '• ,Is•.I Tr., ,< :i'li 4• .r` r .t. I'i 'r i:.tJ. iJ,t '�% 1. ,� 1 'rrl:.r" ;, f :�,1 1 �, it t :i ,i 5 t1%I J, . , r,. ':, :.:. fr t J• ,;� :l 7 's; . ', . ' , , t. +., . . )• J r, ayeµ ,,� c3• •7 .:7r►.F', c� ., ,'e. .,, ,!r.:..r, . t::: 1'. T) ZI tic:<. r{t r �!<l:) r tt, ,;r,-. :..:, t , 1 , r yy xt st` '+,JF� 0.j, :.4{ t. sit. 1 yp ,' ':.i- y 1 . P,:,I Ti�i.r�., �, ,.a ,.. Il, •. ,..:.',. ,' ' �t' .. � :�} _+.i ) :1 '.,. �,{`'r.;,`" , 1 'tl ,::I , ,)I,,,?''_I,. -. ,,;.':. n •., 1 ',.r '1 �e •' .�' ,1,. .'ll •VrI1 ,fir"' J4'�`t. :;y - 1! Y.. ! Ir.: .,t , .., -. • :>. •,• t.: J. :+r3. t.r.r, f;'E f , 11; ! -.. LJ .}.i"t , , :•,..t:'.:.., r•i�.,}• _, - , % t r ,iT, ,,' It rI: �. i, .. r.i!y 'r} iYi` I,r rr ..i ,,.t , J tI , t,: J' . i•..: ,h�. 't..t ,r. ;r4,l• Ir. -i ,• _ '! s ., ,. Irl' ; ll/� ;..1t 1 •.;� �"v . :k1 . tr I-- s. I s.K Y ,'' ,, i ;, , ; r' :)I :n tI ',r,, c .J 1 ch.•ir .�,YS ille,s.. , , ,.. t,: , . ., ,• tY r ;l,t, �. f �•t .l [ .d {t r ^ �• ,. _::'r /,L..l•. ' ,. A ,, f. ,1 ,Y;�J i , J I it It z..• r,!K•A:r I.. Ye/... < U ,. ::. k, t' r ��,. ), 1 ct,' r 'f.. I �. .,,,, -}.� Iq Jt., ,�.,n, 7,.,.: c•. .,., f. .i .,...' i ' ., ,,, ,` .tl•r. , '.;, •7{I I, '�,, ,. f � ��} tir'V t i J , ttnlT ,i ti e , �:• .f� +r ., ) Ir.{ , t, it.,�. ! I i + .�). ,',i. '7 :, t ,.1. I,, t t'-,1 �4• ,,I I, .y, Lf( I a,,: y- r ( t t. i; r ! r t{I 'y%-i .,.r,l ,.., t ,.t 1 ,t. , N, 11 i.. L',.I,I"."�,,I I.,,.-1�,,,,.1 I�I.�,-.1",1t.,..I�,�I:,*I��.:.�,�.�I.��...�-I.��-tI,,,-�,.F,�,1�,;�.,..T,,"I,-,��I1i".-,,-.s I�.,-,,-,..—.-�II,.�..,1.t.-..-I�I�"..,�-`-I,!.i.,,.,��_,.I,-.�.I.:�iI:,,.,�?,I;1II�I:,�:.,I •` i1 .. .I'. •f I t .t1 11 1 ' 'v f , ` I,y t , f; I rf•. , i . 4 : 1 �'- ( r Ii: . , i, 1 4 t {. t , • I , t, \ \ IT !) 1 t ' ' t . . . r, . rjS , I-' " I, n :; if; 1, , ., t ' i 7' - 1 r 'tII ,- _. _ . , ,....._,_. ...,. __....,,_.__.. _. 1 t , '' . . -- _ 1 , r, n.s pole/doeL not i+sure agsrnat bts or Gamr�e Und mpsny will not Pay coils aUaneye'INs rtr expm�whKh ease by reason Ot • i ,', >., Taxes or aNasam*Ills wh.Ch afe n01 shown as eats i.,�'Gans by thu records d eny tsatng■ultwnty Ihal IW...lass or aaa�iamenta of reel propenybrb the li `% ,0 1 r 1 rl I , It .n r,,, yt} I pt bhC NLafUs. tr 4..r1 t ! It; r Anylrcli,rrghl>Llnlerettlsaclai,n�wh,cnaren�lsnownbylhepuUlktecordshulwhtchcouldbesscertairedbyaninspCctlotofsaldlandarl>Ymalrngrnqulryntpar• • 4 ,f4,"� '1`, Al sons m passeaston thereof. (^� ' 1 fcAsemenls ds,ma al easement or encumbrances watch are not shown by the public recatda t t� } t n t-��,.' ` OI*GfeDe^GUs GCf1Yldstnboundaryl+ne4shprllQetnarea anCrpaChmanlsPrinyaRlerlaCUwhtrlacorfeClfurveywoulddiaclose.andwhKhafenollho ,/ T' , t 1{ r 1 , 1. pubtK records. `' .�"� �1 ":. UnpAUnlad min,>q clatMs.rJsarvations of excepllpns in palenls ar In Acia authorizing the issuance thereof;watsf rights Claims df IIVd to water. I, 'i 1} ti i {I•;, , r' ' {) I ' A. Any lierti pf r:phl to m lier> for•srvtGds Isbar or material hotetofnre or hereafter lurnfshef~Imposed by law and not showy by the publ c rccnrds ,' 0, 1 i � F IS�I ,'r��r • 7Y" 1, t• „ it ;�i °! t1 ii, B. AMERICAN LAND TITLE ASSOCIATION OWNER'S POLICY•10�7 (0107) t.,` ' ' ,iJ: EXCLUSIONS FROM tl "''i , N , ' i + t t ` SI "`^f' 4 :,+ ^.erollowingmdlsraute.Dresslya+ciudedUominacovefapeallhi7paiCysndtheCampanywUlnclpat'lassordamege,�ostsatlornayr'Iesloruperul'w,rlrhari:n ,+�rf! t -4, �r j ,%i, ,,S 1„'' I I + ,, J, ' /'esson of. `'+�� , UI Anylaw.ordinanceofgournmunlatregutatlon(includingbutnutllmitedtobull�ingandtoningisws,rlocalnc of&nVi prov menIlrKUng,reeulalnq,piohtDlt ,;I i r It' ' inQorrahrUngto Iq IheoccupanrAy,use,oronloymentattheland; (IQ Ihocharacler,dimonslonsorloce�lonolanylmDroverrlsnlnpworhereallltorocladon '• t ) (' IMrsnc; (iiq esepunraninowner:hiporachangelnthod,monaionsofaresollhoisndormypvrAalothosatsntlhalr at wNch if,,$land 1rlclleeollheanorcemenl11141101 as I : 'i ' `' t� r i protection,orthoeffectatanyvlolattonoitheealaws,ordinancesfvpaysrnmentatregulslbns,nxc.vlt It ,,, �. 1I'� t1i natkeala6elrctllenaencumbrrrtcsre�ultinplrarrievlulallonoreUegedvtdstlonmllectingthelandMebeenrecordedInthepublfCrfacorftart0aleclPollcy. _ 'r (Dt lnygovarnmsntalpo'kepowarnole.icludadby (a) above,ascepttotheextont;hatanotice01theaterClaelhsfaaluanollwoladolectllonarencumbrance , \_ ". iAl _'• ,r i. . I ' „ ruulling from s viola;bn or alleoed violation aflecling the land has bean recorded In the publlC roeorde at Date of Polley, f „ 1 Is 0 - ; (lights ofsminonldomainunlessncncaaftheexarclsothersolhltsboonrecordedinlhepublicracordsel0ateaiPf>1tcy.kwlnolexcWdir►Qlramc,ivefsgaanytaktnn ,!1 , t r ' r1 whkh has occurred p.ior to Date al Polley wnich would Dt binding on the sights of a purchaser for vsl'•s without knowledge, ` �� r r• 1 t Dafacls.liens.ancumbrancee,adverse claims ar other mmtlen: ,' +:, I Ii i , il'. �. 1 is) crested suit lied,assumed or sgrsod►oby the insured claimant: 1'1 (b) ioflea*writ*theCampany.nplrscordedlnlhupubllrrecnrdsal0atoo(Policy,bulknownlothelnturedeioimantandnot dleciosedinwr111ngtathwCampanyby kr ,t1=i 1 � I 1 1 5 f, , ? 1• Iha Insured claimant prior to the date the Insured claimant become an i'Iourod under Ihls policy, i; "- f i '1 A < \t l (ct resulting In no loss or damage to the insu•ed claimant: �,f` "I r t ._41, j, + 't" (rll Atlnehlnq or croalad subseCuonl to D�Irr of Policy,or �r ; , , ,, / ? r1+' 1, (a1 resulting in loss or damage which would not have teen sustained It the Inwied claimant had paid value for the*slat.or Inlersst Insured by this pNfcY. ar , r 4 " {t. %. { 0. AMERICAN LAND TITLO ASSOCIATION OWNER POLICY-1007(0107) 411 �'�"i I ,,,fitr,i • t - WITH i N REGIONAL EXCEPTIONS r"1 •-, ,,% S I �) IlhsntheAmerlcanlsndT111citssxiallonpollcylsuaodasrStendafdCoveragePoGcyandnolaeanErtendedCovarapefolkythaexcluslonaseNalhlnparrgrl,..•af t' 'j ,'r ', ;s ty +;; j above are used and the following 111100l0ns la coverage appear In the policy. + I' `' tT11 l � r / �1 •tI r• SC14EPULE 0 ;, ��},I f 1,!>t, , ; t, .� t I, I This policy does not insure against loss or damage(end tho Company will not pay f:0slt altorneytt lets a expsnsea)which arlAt tr/reason of: / ' �, r.i , f _i ?. I .. I ,, , ` ,I 1�1 1, 11 I- } " r ,' �I 1� Taxes or aa►esamenls ahkh are not shown os esisting hci.a by the recede of my laxing suthort/that Isvlas tslits ar aAae*ementm on real property or by the I 1! ' , Ih,i�rf� �' is r" ' I` J`� 1 public records. + , i r` jI '4rr-. �. v I'j 1. .Ir r 4. r Anyfscls.rlghle.lnlerests.ordalmewhicharenatehownbylhopublicreeordsbutwhichcouldbesscstivinedbyanineractlanofsaidlandurbyMak'ngtngt'!ryofpet` �'t, f+ 1 � . tiR ,; 3• 1 ��I,1��4 ,a \ ,. 1. 1 t cone In posseseloa thereof. , 'j �'t y I 1` +.t ""t`u, , r 1 ,t ,` , 3. Easement*,claim*nl sasslnonl or encumbrances which%to not shown by the pubu;records ;1, .1:e tr t� lea H 1 t' tl '' ' ''( a. OisCrapanciss.conlllcls In boun4sry lines.shortage In area,eucrp�chmant crt ry other taste which a correct survaywculd dlactosa rnd whkn rre not shown sty tt;, , , � r� r., ' ' ^ �•. ,1 ,I ,��y ,. 1• t rt • •, '.7� :, trublic fecafda. ti '' f r, `'. , t5�`•7 )) ,`..ir�n"tr t 1 `� >' Uopatonted mininQ cla!mx rasanotlons or exWptlons In palenls ter In Acts authorizing the Isauanco there*.,wafer rlghls.claims or tills la water. `SI '• i r ,. ?' eny lien,of right to a Iloc for Nrvlces btror or matar'ol Ihorotobte or heroallar furnished,Imposed try Irw and not shown by the gerbils rer;ords , '' I 'f;•, 1 , ' � u ;, '� '. ^I r t 1 ' , i II i 10. AFA►:RICAN tJ1N0 TITLE ASSOCIATION RESIDENTIALTITLG INSURANCE POLICY•1 q97 �''`I",ir r?f 'i i ,:i , t1 )} EXCLUSIONS t :r rt r2`' ., ' S, , ti� 1) tom; ,111 1 M !.1 ,L'', ',rl addllhn!o the Exuptlons in ScMdule 0.yf u area not Insured against loss coats.attorneys'(ass end erper.atas rAeul!Ing Irom ` III I. `*� u'�.�IE t ;7' it ' " ' ' 1•. " `� L tittrernmartatppiicsposuer,sndthsextstancuorwatr►ticnalenylsworgpvornmanitegulstionThlsinctudasbuildingandtoningordinancesandalsotawy r .".. l q�1 . I ,I ,�• '.i ; aria regulations CanCernlflQ: { Ir 1t7 it f•„I I 1 s,• ;•',l4't "r , ± : A �'', o land use • land division. f ,' I.' t , t t' }1 �1 ; !Y • improvement4 on the land • onwronmantal proleCtlon 1 �. I S�, ,, This exclusion Does not apply to violations or the enlo:eome nl of these matters which apperr in lhs pu31iC records el Porky Dais. r O. 'r a I ' , , , " , ` -, 1 r '! i��r'? This exclusion dome not Omit the toning coverage desct"d in items 12 and 1J of Covoteo Tills Rlaka. ,J I�� 1� ": a J ^;� 2. Th•right to lake the land try condamntnq IL unloss a notlen of taklnQ appears In Iho Public records on this Polley Dail. 1 ,' tI I . - t�� j 1' r,>. s,�; :,'r TI(le Rlakx r�l � 11 fir ` 1� r , (a I t • that at Gresled allowed or Agreed to by you `t: " f , t rA 1�1 t r O that are krWwn to y04 but not to era,on Iho policy Dala•unless I:iay rppeafed in IhA Public records li ,rr f^+1� r ir} i I: I i 1 ii i�� " o "S 'It') L j ' a that#@suit In no lots:C voU � 1 h� 1 .,.i l - !' ',, 1 4 L ;S r`c'+ti, `' `�� IV .` tl • that first sHecl your tNN sitar the policy Date•this does not limit the labor and material lien coverage In Item 8 0l Covered Tills Alaks f^I " tl , t I r� I S Sidi` II .tI' , / t C1 " +�' t"1^� 1q1 L t ""YTl i 4, F*lure fo Cs1 value far yaut liUa „} -I. �I'I ,t,� I " 'I /,�a i T, "� rl I 3. lack d a rlghl: 1.5'1 1 ,.' { +tiht,\I -I.'�r� ,� f,-( �,,. 1 rf I ? r,' r 7 ., Lktlr"i ' a to any land outsi Is the a►ea Apeclllcally described and raterred to In Ilan)3 el SCPsCut@ A or �I.A ': ^ F- R_';•`ff t'i�;. ,r;�' ti �t tti. „ r •r' r ,r J�� 1•j r2 1 I,i4 '+'1'L,;0t ,� �� i' I� • In attests.atleye,orwslirMiysinal touch your land r�, .f / �,�{- j, vll p I. V Ir a �} rr 'rl�t S+�f `' } ' This exclusion does not limit the access coverage In liar"3 of Covered Tills Risks .! � fI`ra is ' . f i �t _ ��. .++. /yt•i•'tr.,. r r" ` x{ t" , . " ,'.. .._ .�•.. ..A. »...........•.+..+..�.m.�.......�ev.+'r„� 1.-.. �^ 1 I V, .F, -, t r/f J; 1''; t,,, �' r,i -' , .', II 'r, -.. t-:- c ,: I ,l i.,i . t r .� t F 1> '#i 7 t �`��Ii ... q *?;: I l,t a t t ,, T t,,) r 1, n r.. . r , '.3. ,ti. I" fijh�, i �' I , j�,' 1If 1 ter' I ,ti. f< h� f•1 5.. h.j,. - sr'.' r ',.�• w EMI ','t" f l�f r I 1./ \, ! y�i_ .. '>h 4a,. f �.r ) L • i\ ,t 11 t 1 ; A t^ (, �11,�.1 :. i... '$.r .. .,`,y I'll ' •r t '�{ 'n .>�{ 'f :,'4 L' ..,• '�! X' t a,,.1�1•, ,;. .t _.. :. 1' iy 11:, y, =;' t :.,1 f. j -,i!`,i, ..,,•YR. kit l: I. , .:..:.. ; , ,. . ,Wr r1:`•i'' I, ifs ,'ii♦• ,Sri P•_ .+-.1t rf' :', 1!, ,..;y r: , ,, ,. •i,:. A f }Y :1. +5�:}:, II J S •:'. ' 'i•�'1 + :,r', ' 1. •-T' .t(� 'tl 1. `.`,..t� r• ,I? ! :il fif7 I'.,�1 q'i., i-. .. ',. 1• , r — lea Ir;. '�'? '{.:�;'. •�1.. : r 1(, , _ . _.j ��.: y tr i` j1,�Jy:'. :J41,5 ('• ..r ,r,:. 1 S t,• ,It' it'., ,�.'1 a. ;1. 1,, �j _ ,`r G 'I + {, t�',r�, ..1, r,• :plti, 1• a.., ti , 11 y ;.p4"`,5:.'1.3 .:: , vYA;.�,:f 1- r, `• .Ic .:I I, 'S� , Ii _, 1,1 + j .itJs 'I, CIt.f.n� ,� �a ,:f 1'' I. a ,k :.t�. r`xy . J r: , - : r •,y. ,�i t •tt _ n;,y..;.�,t. ,,:i-_t. : S', '+ ', '1 ,`(t.`y .S• .ram:rl 7:.,'t., ,I,,, I s.,j1:IfS'..Y_i;•r'e.! .�_�-S�z.}Aa r •. �' - :', �I "., -', ,:., �.J d 1 ,r;�• h.,y, f�i,. 'i l!.,� .,�•,IC.,. :. is :I . .. ,: f ,. , Ir }.tiY9+,;,�:.ly z�',,'r.:� =u It , '4�,. .S+i.' ,';,:'_. '.it:: .,'• . .I. ) ', ( ' '� 1 .1," ',:? l• - + j 4 ")' i II ./ ,1L. a,„•1,;.;1..... .-J•> ,,.>J_,. ,.-' :•! ( '..ii,� .� rr U " lit 7 :�L;iJ , r�1- ,• • 4, ..f r ,,_ ..I .'.,. .,. .;5.,., I,.,, 1} '.1 N4�r 1' .rl A ,.1, :Irv:. -- :, ..I ,,.-: I , :.,.5 ',. t .. , '� ' .S••.) l I,40 ! {`f,,.,1,. ,I r .I t+ }yi ,,% :I.3,•,. . ,,, ,�,., I 'r 7 ';. 17 p, :y. •1._� �, •;.j t' r, ll .5,,, 1, t.. ,.. ,' t r .t�'. tJ: �.asl�t�r�` 4 , f yy i�• t,.r:, i:. I .at 1: 1. t:Ti` 'r :i ;A Y;• I�: .r. i _',I j,. ,,i •1,,, t� [):•{,, „. _ ., I `� ... I, , I'^:).:f ,ii .':f,r. I t r r.. . , 17",1. . :. •Y - ,';, , , ,n•, it �,,r. , it-! t , •� 'riC r ,i?f ::• .1••ir. f._,�... ,, ,.,,, tr,'7. „r1 ., 1 - .,i�', " ' 'ti , ail :�irZi,,4 ,j:, ra..1. ,.,., -. r. ._-I-,.r • d; .'I �rt. :i 1I I.r {i ' ii+'' r- r ., ,.t, Y r tLa( ,.+[ ' .y, ,.,,.:.- ,.f' :1 .I I >. ,.Ai , lit Ii' •.%, -"J( ) •4 ,: H�- 'W I ,r,. , .::)1.. ,,—. .. . .. , , . .,. '• �1 1i I` +• ..:..ti',• —I •�� '+yy'}-r.;,. '•. !♦.,7, 'i lJ .;7. } .. , c,w" t.r. Ir'.,'4 �� .. 'tit •,F f' ..,; 7'� '•r"', (� ( t , ,I w •;4t,.',, )lI.. (,1 . I ♦ a...'r'�. } �l•• ,i•'^\r'_,,.q .I,.,'t '7 v.. '' v s.'ti * •N. 1 ) ' rr. �1 1 �y„Jy )fi' I',.•:i �... !'' , -.f 'i - I,. l v r ,•�1%t ,� ,Ir a• .�_ w f:', 71 ,Fr. 'S .SfiF.fr;1. t 1i . (. iI, I 'r' ,I'' f t r ,I • '1 • .,,tt •IA. •r r i� ., r:. t •.,r: r --.. 1. •i •,. I ,V r' •• - rf i',:I v iY r, �, i •.t :.: '' •:Sv.4�, r,•4 �' , ,t t,;`, .'� t f' r r I 11t�I , ; 7 .I` t,: II S ,t-, „JIl` 'S i' .� :. r�"'} L) .1. ^'i! ��'S',,l r j is r �11 ,I ;, '•. � , ,• "' } ;) ! '1, .1 ;i�p ,r•t� `+i't 'r14 >-.L.;rhj •�+' .l), :j%' ,' - r,'{I. {A ,, 7,,,: , , t }. lY �,�vi . "i� .I• ..S "N ,,,ff !'. ly�� .r I, :, �. ..tr '. '}rl I ,,} •'.rt If,.,'; ..5 1 4r'{ •�., a i ,�' -i .A I' ,I I � , •: v• t1 N, .r t• ,/'(, +Srr i yI )' I,/ 1 S: - i•�'w ,: - {. [ , -,'wc,' ti , , .` i.I, �f.. tl ti ,a; a 4 „i+ , ! I f ;I" it ' ,_ .• j. ,,i� r";�I n'1' r. o-.•. ,.., -,I 1. ,'...>. ....f.l.$ 4 `,: 't,f. r.: 1. I 'r. •J R t(, ..( Y f a -•r' �. h•' _e, , :� , I, r •, it 1 ',,, fit,. ,>r I lf// , , ,. �;,,1�, y i, ,, � '' y1 ,9. IIr,J I. ,I •II: .I .) �.;.. ` f I,.. ;( l ;] ..W, } t' ,, rI." �{,� i -.`,�{•r 1''r�1'1 titj. 11' '),':; j'-�\'.., rt :f i i• ', - , 'f, ,I `K f• 1 , , , I, It 1,? _:,. !t•A C'�t1 t 'r :J1 J . : III. \1 I_?.3�IR.:�.,�1.? - r• ,.�I*, :. + /► 't, .",.I�!..i.,-F;,f',,`.I�y�-.1:11�,r I�,,'-�I.t_',.I'1.:,,.�..1?�,4I,.--�� P.-,,�.I_.,I,I.,I I.�.I.;:...I 1I��..-,�.,I._.*-):'.�",�,.-...I'—,I4,,,",..,,,. YI.I-0—",-�..;...j.I.�1�-I,,.,I�...I tI;:�_...-, II I . 74j , .. 4 I' i :. S . . .. , r: 1 > t , , ti /r : )� ,, t : „ ,. a ! t ,t `1\ 1 ^, - , ;, , ` ;, ;,N ,ti ,+1 ( ` l l�'i 1[' t iI'' '1.,i ,t CI S `1l (j'• +.1 f °r r ,t! }} t. 1 k i 14, 1 I 1 ` :.I I r��'•+t ,� '} '•F ,.I tl 1, .! if , , Jr.';', R1 } ,St I I l ) 1:` f : t4 R II i• 1 :. "..l,t;...".s,t 11,,..,.. �i.,,;,„ • 1- b d.: 1' ),1. 1I1. 1+ ,1 la. t III ! _t .. , -. _,.. — a Ii.,a.., .. I_, , ,.......--4-,._,.,—..A..f a..... I i ' rL-f t si �.. n s t 11 [' �,..t', .i • ` 't : ,may ,', d! i 1!1 - ' G ,f1 N4:..,%.'�.t" 12 , ' i f. T) , > 'dIn , '+ t' Is " 1 , .N! 4. t . OR-1a8908A ,. ''t. ,,'" FIRST fERIrAN TITLE II`SURe1NCE COMPANY !`t, '`' 1± ''' tl '' 114 EAST+.': It a'IFTH STRF.ETt P O. ) , ( DO}C 2 67 i .SANER A ,''i'I i =1 NA, CAL,IFORNTA 92702 -. 714 1 a 1 �.: { 'IA ', ! J`: ( �` CITY Oi~ HUNT,tNGTON BEncH r: �j)"►: G t ?OQO MAIN S''_'REET HUNTIN3TON BEACH, CAI;IFORNTA '1,' ' `.j I �I ATTN: PAUL ay L1lRKIN - t .. ..,i r'. r3 Ilf 1 i ,. 1 , YOUR 2t0. 02a-1a7 t t`r:4' - "10 SHANDRICIC z ;' ,.'! lJI ;1 ''t '+',' r IN RESPONSE TO TiiE ABOVE ,f y�� , ." ` '' TITLE INSURANCE, THIS COMPA,�?y FH�EBYe APPLICATION �� -.i 't „I FOR A POLICSf�OFf��'1.,,�t ,'. ; ` I, I„+ ISSUE, OR CAUSE: TO DE ISSUED REPpRTS n•J ti, XT IS PREPARED~TO f':r r r; �� `.-rJ POLICIES OF TITLE INSURANCE DESC"hI9ING EiE DATE HEREOF A ' . {! `� c' POLICI' OR ,r J,J , ; �,, »I, �.1 , rig+' �� , YNZ'EREST THEP.EIN HEREINAFTER 5ET FOZTl;, rNSU LAND AND VAE ESTATE OR it ,� ; t , ", F1, 7,. iS'i�A�O EpSIJSTAINED HYI REASON OF AN1t DEFECT (� 1 , RING AGAINST LOSS WIiICH , '�� { } ' : 1•� R REFERF�Ell 'f,p AS , �•,IEtd OR ENCU'MI�RAh'CE NO 1 a ",+ '��,,', .., .. � � EXCEPTION BELOW OR NOT E7{CLUDED }7 i `�t 4�I +`,c{ COVERAGE PURSUANT !'0 THE PRINTED sC FROM f �a ,,', 1" o . j ' y !:_ STIPULATIONS OF THE POLICY k'ORMS. HEDULES, CONDITIONS AND ''} t",; 1A" ' `,; r , ,. t ` ,r t �� l',t ijflr �t1 '��j *t�a, 'Ia� t IiE PRTNTT:D EXCEPTIONS AND EXCLUSIONS FROM TFiE C0� I��`?., ' `'1 '"r,,,, 1 ` ,tt ,` r ) 1 POLICY OR POLICIES ARE SET FORTH IN lERAGE OF THE l l , .' , sl,,+ ,'7 ,r`,�' s: i THE POLICY FORMS S CI= BE READ. IY,NE EXHIDIT A I�TTACHED. i tk�l 'tl ± t t wIiICH ISSUED THIS REPORT. tE A IRII,A9LE FROM TF:EPdF FICh > ,. h fw i' h t ''..i 1 i 1 t ,rl I. ., TJiY,S REPO..^"T (.AND ANY SUPPLEMENTS OR AMENDMENTI�' ' r``'s{t' ,t ` f 11 f J , ' , SOLELY F R `' > - ,I { ,, ,.�1'.c'� pZ THE PURPOSE OF FACILITATING THE ISSURldCEROpC A, IS ISSUEa ,r rj rr tf ; 4'tIG :. } TITLE INSURANCE POLICY OF 1, rr�' '`r; :�ti;°,`' �d a s ' li,%, i `; I i',{ bESIRED THAT L7AH TyNHE ASSUM ;Y IS ASSUMED *,1 ? ,� ,I 1,! OF RD Pk O KEAE6�f. IF IT IS f '' ,•J 1: TITLE INSURANCfi I R To THE ISSUANCE of A POLICY ' r'>�,�j}� , Ml= �'t v` r. ,; ��'� ,' `' , A BTND?�R OR COr TMENT r D BB ,1 '% >.+ 1:''%+' t1 , 1, r. I SHOU,� RERU83TED. �; I ;it, 1t'� '. ��I = .-, t �f ,� J ,; Sfs rI, ' AS OF JULY + DATED 15 19$t3 ,� �r 1 1� 4 ~; "' 4f , 1 t AT 7. 30 A.M. ' 1 Z�'.; J` 3S {, // t; 1 J 1 1 Z 1 II 1 "r rl } tit , j fit `t..:a .,t. 1%31t P,It , L BAKER TITLE UFI''ICER �----� ` i r„a�"� f i 1 t,vipl S _"1 _ IJ 'i t+.e, ' I t( TtiE FORM OF POLICl' OF TITLE Ifit4U :: f `t+ j ; 'J# , ,` ; " f'< , k�} '' �, IS: A9IERICAN •-t RANCE CONTEMPLATED BY. THIS REPORT ;r tJ � '' r ,{ art' ;,f atANU ITLE 1 y'~ ,,4 ( �, ,,} J`,. . . R' 1`'` EXC�;PTIONS !E'rANDARD C VER.�G$�Tr.O?t OWt?ER:� POLICY WITH REGIONA`. ',;l{54" ,' rt jS.'' 1 J9 II C , I ) ; ,,1.. S ,.) y�+ . }, -. ,�I,� 'r : ' ' P 1} �J t� 1,1f,f r" I . I q� I I .. L ',�- ,I t', .I .C y(` j 1 !t {t t ' tI , j"yt»t,iY Cfjal ,;,U ,,I - "(`°l'f? ��Ty',l`�1� tir 1a , : i . ,(t�'r 4 1 ,:' .' J".+ { 1,fit'Cf ' 7 , + at 1 r',, '1's\ (t`:'<'D3t ,t1.ii tt�. y.,t RJ,E PAGE �N �`.)'w^ 7 II AID,;`1 1'1 .i,>i 1 r t,t r,t�rjt ,;. 1 11 1 jy r "!+ G3,•�{!.��1`1ti`K tl 'f,��), !! Jj `1r (� tt i`� �� . tj! . j r , k l�:i;`.kP Ott! , 'rt �,• . . ,.' !,�RYf ,•1 Y 7.� Js, o".raf;b ,J, ?C i . "Ti, ' 1>,``x I yr >r l 1 ) 1 L I - �. `li li' t r 1, ,1 �^'*e-T 5.._�,. y »«.AI rw,.' r ��a^+i'Scrl ^1--^ ,.rt'� ,. _ w 111 1 +Yt t �� , ).; /: 'Fr •�. .a, �,�' t. `a``at r, 1 _ _" Jn .I.:Y-�:��y. �f f •!-. i i u, ... _ „: � ft r'; ��5� Y v1+1 / 3 M,'e k� 1 r c .., �.'; .!(F l.Ld1. iJ,. �,J'.�, ilf;"Y r_ 4`�CIt it ,ya .( j� •. ,, , 3 ..-i'1 �.. .,�� i t1 t. t , ., „• ./4 ,3-I:.ti,, �•lt ,j,,.. ,',t� r ,'i, l ' f.r 1 ;J:. : � �L:. i. . ;',� *r14';�:, Z;;i�.t.SXI}� �i fit. ',I Rp .r- _:, +i'• .r•l . '..--i ,I,..,. .1. . ^r''... }.: ' •. � t , ) �+ "f. i.'�,7,;5•� fi:•... � �, �( y ,, 1. ,� r�.., . :'(,, • t...�., , ,1." . , . .J I': 1. i , } l" .l' ;- -I !lt.0* , . a, -'i'v ' ,J,-4 i�il J k.t t,,,,�.. e , t , ,, '.1�r .1 . "1: �,. .�., I S I. ,. ��y l, '"O il'j ' 1 ,. .,�; _ +,". :(.fir r' ,� 'i ( •I, 1; I,., .( 7 .+.w•.:.i� 71� :, J /�1. ..r✓' ..:'X , 171„%. %''i. t:` ,.i ((u °•'.. L 1. ;,5 i"I r l a , •t .J'1,... 1 - ,,TI'.,,x{. d ;, -J ,..,� ' ,.'. .Y _ �, .;� ..1ti k .rtY.. 7. '., ,f,i 1, ',(I, 1, , 'i' !� f 1. Sg/,.. A , 1 {• ,>; ,.p.J H t.'.N.. Xj.E , \ .�. ' ie• 1,,. , 1� %' a2:��1. :It °tt' r•1.,'r �. j ( y�(j t1 ,., 4 .,� '?..+:. .,r, 1 7•,,,,i.1 , t I, ,,. 1 , + { ;Sr,l htd,, I`i �' 1 F 'r: t 1, :" ,,rl .t ' y:• 1l i, t , 1� v, x�4 .' 1:[[f 1°')��'l .. ',',.,-,l] qt 2.. , , �. ,'lr..-.: �! s, t� IN 11' j'� ,r. 1, ,�L1 f.•r: s p. .fr. ,�" 4 ,: , .. .,i , ..,fir: ,, .1., , :. ,. ; I' ,1,, t. 'S ',�' 0' _r. - ,r l �. +f r , ,� 1,. '( >' t i,r r ,� .�.+ Jt ,. ,n„l j. !., .ti , ..� 'I �'., :i` -, ,a ,1 , .'�, , i', r��. ,:li'. j :flf' t t, .p� �+ r,�. ,. ...T�,, ..., -7\.,,.. ,, I ,, ,�:- 1 .. 1. •Il. 'r .i 1 ) .ir. 4..tt.j .1i. , y. I; y t,, f,' ,: •:,,,. , .,, •Ii , ,,� S.. r. . r' ! / 1 r 1 I, .1• .I t j <,;�v.. - �:o� C,. e.,.. 11 _ t i �, tl. (<4 .• it [ ;�., :, �(.,,, .�t , ,< �% rat: . `,'.�, t a,R, t I'W •,.:, 11 .- �.��..., • .1,1p c ZL.i , , , 1 .t 1 l /s .,�� ...,,. I. . ,.�..,,., ,.,5, 7.�.. - �;,I-,. ,,.,, ; 1:,.. ,1. . ..., ,r.'.. - N , ,.: ,y," l l ,k .�,' t.. :. �t u, {�..:;;• 1 ,, 1.., I 1,.�., .i. -��. , ,-, .,,��: ,t 1:; 1 I t �1 ti1''�.., ,i �Y + I t. r Y ICI, 1 {Y j y / [ �� 11, . , ! ti , •,;+ i:,:.'i'I'l t:T,;; t ,,; I , , 't. . ,. i ! ,,, l: ! fI yl : 1 �'f ,. t' ';,1�-1 '7 " ;ll::�t ,ll[ , I. ,,,tir. , ,. i,.. t .li i, - ! t �,",1 , ,,i ,r,l(+y'1 +1 t Stu.. .,I . C:+r.:` -fit...r, 7i1. J. ::: I .',�.•. („ „ .,..,, ti I i ,: , J> ;i„i: ,1 titr+l;' 'S w,S C 1. / , , K''. �. I. ..fir .r ,7. ' :T (,-,..te .l,'S,,, :,, If ...,,�r ..,. t,', r': •e c C !. y , u, ,, �,T, � '.ir Y.1.` br .h „ .r. P t.. ..,. :1„ , 1 11 , t �i:'',` :`;� jj t, ,tal'4kyy.+.J Jf,�.,.. � ,:{ . , S, ,+h 'O �!' I. 1� '! iL" 1Y l 7t :,'� 1 v,,.".` ,7%3 fl „Ij . fj'1 r'i ( �`" I1 t + `�, t .+ ., 1 n•.,, "�I},. Js",� I 1 rt I$.:,,l. 'f,y./;I �`f..�,tn 1 + {_ f - ♦• 1 ,,'. i •,+ '.t, i -,J•',I tt ,,1 '�f. i�+.�- ,yM ,. , `,I f ';�lE ;:., .,...I .' 'JI' ,'t+ , + ,•' ,1 .,.�.•• ✓lt ,-1'• :.:::,. �, yl '" +t4 t. i r 1, _ , t ` �11 k j .•.; ..; ',.y�y'.,. e,� .?_ ,Ar r I,.. lr y.:' ,. I.. `�..i 1 i,` rI..� .;' t .. .':'lt''•. .T Y.iJ, ..� .' , .. ..- :,:. 1. .t .:..1 .;:•,1 .til.. ;: t „ - , II 'it ,f V:"I , r'LG.t;%ij�,' i�' I' t :y ! k, ',:,: rr [ , ,,..fJ,-. i'w;,, J . - .i :, ',;1,' 7.'�•'.. R '.:-. �.�i3i6.p..+t 1 d 'Y• ,', �}l� } r F }, ,,,,}r Yt 1 I, J ,�/ •fs.•J�c '.4.?�f t',: ` e1 t. , - ��, , ., 1, .tip I 't: 7., ....! ;/; ;l' �. ( r } f. , ': ,, ,art ... 114. k r,r!_`,�l�,i(,•'y � rl, r i, t ,, 7 - r} .r- J C l� rfi Jfr 71 , om'• • '! r•� (!�1 7 �>y� 7 1 � � ` f t1 `l ! 1�� t a` V' i L � (IrL} T, ` •'3 �A ij,t,. • ' 'F (�,r�y''1Ja' t.��r t• t'r1' +1. ' .i (t �i� 54 -.i ,� , �;, a ' r {•� . Y , r J ♦�� '� ,.,...........s.- d�S.:tr•rr'--•ii 'ny �r TJ �t 1 t� J.+.1T,��,_:.S'.iL'.':.".ts��Lb:l�::a,.,.w•'....a....«».�..�.....w. ,.....•........•�...r�.��.•r.��..�.�..__....__..._ .. _._.._....__........'......, ,. 1; t ( J. r ' 7 ;,, :. •r 1. 11 / . < • , It 1 J i ugoss �•�Jr` �"j ',1i, fitt 1'j; •' , r '� 1�'Tr{ (,.•r 1A VI it n t 1,•+� ;, 1 ! TITLE :O 'rHI' ESTATE OR INTEREST AT THE DA'rr. HEREOF IS VESTED IN.. SYLVIA S. SHANDRICK, A WIDOW AND JAMES A. SHANDRICK AND SHARON C. SHANDRICK, HUSBAND AND WIFE. t �(t , THE ESTATE OR INTEREST IN THE LAND HEREINAFTER DESCRIBED Oil REFERRED TO COVERED BY THIS REPORT IS : 3 •,tt: 1 �yitr��Ea { ,4 ��! �' f ` 1 A FEF f +: ,, ��,1 i•6f 1 fir' 'trt,r`�1-" �•�� AT THE DATE HEREOF EXCEPTIONS TO COVERAGE ' tN ADGITION TO THE PTtIN QED EXCEPTIONS AND EXCLUSIONS IN THE POLICY FORK( WOULD BE AS FOLLOWS: 7 r 1. GENERAL AND SPECIAL TA.:ES FOR THE FISCAL YEAR 1988`-i989 A LIEN tt t NOT Y2EI` PAYABLE. ` k y1 ' ~•;rJ ' tt 2. THE LIEN OF SUPPLEMENTAL TAXES ASSESSED PURSUAIfT TO CHAPTER 3.5 J rJ, COMMENCIING WIT11 SECTION 75 OF THE CALIFORNIA. REVENUE AND TAXATION _Lt' x< =t:r! CODE. ` r ' r,1 f 3. A COMMUNITY OIL AND GAS LEASE EXECLVPED BY A14DREW E. SHANDRICK AND SYLVIA SHANDRICK AS LESSOR, AZID BY BELOII. CORPORATION LTD AS ' {" LESSEE, RECORDED JANUARY 21, 1955 AS INSTRUMENT NO. 7242 OF OFFICIAL RECORDS, TO WHICH RECORD REFERENCE IS MADE FOR FULL PARTICULARS. NOTE: VARIOUS INSTRUMENT•; -.APPEAR OF RECORD AFFECTING OR PURPORTING !r�. t .' TO AFFECT THE INTEREST 07•', THE LESSORS AND LESSEES UNDER SAID LEASE BUT THIS REPORT DOES NOT Z:OVER AN EXAMINATION OF OR INSURANCE AS TO THE EFFECT THEREOF, OR THE PRESENT OWNERSHIP OR CONDITIONS OF SAID J fir;!'Rf"`I"��t.r•ti ; ,` J. LEASEHOLD. 4 . PRIOR TO OUR ISSUANCE OF TITLE INSURANCE UNDER THIS ORDER NUMBER/ WE WILL REQUIRE STATEMENTS OF IDENTITY FROM ALL PARTIES. * T '�� , `7lj+� 1',;:< •��'' F.-S�sIF lr7. $ SJ+� lYx fi(.} J r , IS , J- t 11 jr, {,/3(ti! i 4�' �Gr`v+s 4 � l' � �. ! ,; t11( �.L )`'Jr',• ,aliifl �{ Y�r�. ti �`�1; tr � J �r1.. (; �CfJ-•+ tJ = :7. y r 15 }• ,. PAGE 2 + a a �Jt I�r•p I,��,�IY" f •, .�/I Ii,nS', ��t,`` r ;y�, r- .A' Jr �� ,i alp J.',+.{,(.?• ... ',., Its.»i'• _. "'►r, r..• ,:, """"e�r'ra;G»�"1'.1iii"�."riT ,. n .,r;.�?:a_+ ;E...,,�1 ?�9`i`'z',��r-r-TN, ,+-�; .iY��• ti...e�.,ti_.�,..r..�.T,• rT -- - r.,'� . �!t Y..v, a;?C41;'!,,; _'110..v � ,''.,. ;.�--i-++�... .5 t. , y. �?� •�• i>`: � r 7 !r � .k`C'•t�•1 r.'rt •1''t.• 5:.,:.'- y'r ii':. •J. ,:1+U�i+ e ��,-.,1.. ;.sl,�• {�. !.. .., rr" rc.,1.` +t 5 , '+1,.,1 ,'L'a��„ �1 � t ;J }• , , ..1,a ti;. t .,, '.ri,• ..,, 9a ,t.:.h i, :,-. ;� , 1.:... 1 Y , {, . ?r. f ., .,:. l � i .;�l - •S`:... �. Is, 1'1 v� ak ,1 r„i . �C;.• i jet,,, >:•: I �-.;.,1 :;.f - .-�° .Y 7 ..• . i ...,fX t., .- :, t .•1 ,• ,, .: c� i\. i,`. •-, a i i r C Jp ,j••,,r. ti l :, r ;.r.t. � ,:•. ,t.. .i. '�' r 'l• �a ,h t;:'e,: �•i� �zr, '°';':_ ,rl •, •,r'U�f,, eef�' ,,f '�r,. ri F /: - .r ,. r. !' i ... .i. 1, 4 !/ t. -�•i•r f� iJ. •i, f Eti 1 1'J }� 1r. •�� i�' ., ., 'ice •�.rr {F�••1 ttr.. if..� ' f;. r 1, v �. r r•te ,i ,r �� ' ,.) r 1 � rttt.,;...uji}'• tti , E,.•1!:!t ;r { 'i` !-C{{ f 1` 't,� ._i },,... j,1 1. 4 •1,. `,`' ;;.' .:.' t( .; .r,. r' a. r !';'i it� 'l� ,.y J r�'. •{ (7 .(.. /_+ F. h t; ,� i, ''i.r'7 'i• �1' ', '7: )f 7 ,r J;; %a1r.k�r � r 4 - ry • is L!V :� SY.::�-•., ".....,1 t..', • .,• ,. ll '! / �f t' i�, J, T'.: �'''i,J , Sj.X':lr -,ly. ;.'; ;;.:.•r r.%:' ,,-., ' r �ht 1`i! s r: .- 1},`• , t '. '1 - ' „ ;,,, .;tJ.,� .�.� l.41•, `�• 71 i>'. ,4,�1 idl''V(Fj '+':',{ '/''••'•-•'� �•_: � .; '{, .`, �t ".i.. ,-,: ! ti ,1 .1: i! .�•,}r. °f ��.?-! •� ...� �r"'at,�+:;�,..� f1' '�•,' t .,rr+ , t.., .:;T� ti '.yf t„ r ri , f It t. ...�� ;'.�•, tF.� 'r. ,%1,,,%1' ,. l •y,) � .4•: .ir,,;":.1 �: ...�,.r�. - •..,,•� j.f !• t- fr tG'i�c r „ ;�,�/- f.,,,'•r � ....•r,.n t..,,. •r - ,7 .t,.- !_r 1l��. .e •'{{ f "" ? t. -r ,, li• it+ S7. ) i e•,./ c((x :a+ �.,7 r. :_•t.�f('.rl�(' A�,.�-�Ar r' '•�F.•$iJ. t' 1 ^T �' .1` .`J �i ',• - .ti t:'Ya: Y'.f, :! ".>✓ if ~tf ,,Y: t to. .1, ',,i^ ,,,' .',� 1. .1. ,. �:l..t � 'fr ,l, t. �., .i'%t..1'1 , .tv�'�' a II.,.. t^.q.d,dSi it %r +` r ",! 7 7 ;f` L ++ l"•�YT'+}� �` t:, �r •,,•, , .l1 r. 1, r '•' 1, 4.: r. r. • r :tf .� /,;� f ! �'i::,@dx, t�''� ..A �. ./'4. t 9 't 'r - \r , ♦, 'w r 7. T f i��ia 6. .l.Y riV � I,. '��^�,a i�1-7,,�/'t n!, + .•; 'c!'','! .'.:.`. liltr. )?.r J '-I' a' T,�` r�. ,. w�j: '!'• � ,X'f>...5?,,F' � .,.. ;,..:, h{ ., •..�: ll.. •`:.'1•.e.' 34 ,Y�� } �,-ffr . •'.»�': [. 7�.: fl , .�. T k ., }�':3� � �.i: r. �. Y:• r``.. tr. ,!! , , I '•!; ��'[} ,rr J'+. ,il'• � ..e tr 1; �. i f..�:i. 1. t`,}y l �; Y•. ��F:�1 , 1: •r�„ r: l _ �r 7,, �. t�l- J'�•1 iClf,(t ,...:':'l. t•' t :f,,� • , ��h�+ ,.'. �, Y�;r .r .. J t ''i�• r "'''' - ..1� '1`.:,,�5-.:� � 5, 1 r ��1 Z.((r.�'fa:J r.: , r'5 t i � Sr .�1 +1 T i 1 Yf r' i7. ',t. 7, '. �•:.;,,li .. � ," 1. .i ,`�'4'. 1.J1 .y ...,.`Fs, ''' �- !" ''� .;5 r. 'a, -.. , ...d.i ,rt•� ., , ,.. . `%�.�' .l,.... I h,• �' ! . '$ , .. ?' i+ \S.7 -1'• ,,' •'+ 7� ��. - �.Z ':x, 'ry. `1!' .!}. .'i; 1,. �,, r)• \+-. '•�1 �}:1 ti ,i ,• r?� i �,.-:r f, ,{. ,•.f tAl�;�!�'r,.,.Jir �ij�iN r'�.r ''�:cv, *,t.. -bl;.'F' .1`1 'r .. 1 , f:. 4. : J.,Ss.•1`, '�: ,P.,,�i+-,i ,I •!'rl /, ��' tt .t ,� F,1 ! 1 '-j., it ..i,',}U{•;, f•' �. S. `•'�� 'r�,��^f+2l.�Ri:•t..��'? 7 i1i J , ' { f „f" :.,1I.Ye i t: y , r ; i, _ •! 1'•,:.. 1..•.r �'irr r! ✓; ,� t \f.,� j I1 6 '; Ij - r I '. . 11,I,�,I.4--.:j..6 II.1:....,,%� '��.,.�II..l;-1�I.�,.I, ,:.�I-..�."I.;1'11�-�i,-4�,-.,I,.."'-��,,..'i� r 1l � (y .I-"-),",.--.,,.,-,',�-;��."��,�,..,�',,..Z;I,-,'�,_4�'.�''t.,,..,l--�'I,.",i1 I-'i,',I.-�i I'?1.-_4..:I..- t' " 11 ,T(, t' SI` f 1 t , •2 4r [ ' S3 � :j �, . n l;'�- "".._�1_�-.,.,-"1,. .I , �y``��,, "l! f. r :}_ " -S' . i .. - 'ri (I 1 I {1 ' tl , r' t= t 1l`rl t• lI t _ t I ;I rl 11J 1 ) Ir it r 1. -7 I. a. 114 - t• sSY , I) _ "-•+ Wit• ?:. t A tr s , �k '_thyf i t 1 it ;, 4'! , j ' •i II i ,_ •vr 11 ,1` _ io i)` 1 (! 1,1,-t rj4. I ij, ,1�1'.t 4 - •l: ' •'! - •', c.,,yS ).,14'I t. F `M .l' , t 1 J'i .I' 1 ! r . e 1. / r .•I 4 ,, 'I1 :'L .-.y:..}1,..wL"•�....;.K:-Itu...,.u..u;».>•www.nlmle.,•w.+rw...�.,- ..- .._-..,..._. e.' is °Ir r l 1r f��11 Z i ' ,... i �` t,,. 1 .-',..1�.",_I..,,!C1,..i.I...-.Il,,.I,,1.I�,-'!-I,,,.�.I�f.It...I"I,...,_r.,."..,�,I�."',,.,-1,,;,,..,,",,�;-l,,-�.��,�-,,�".i,:.,,.�r-1iz_"-,�:--.'..'-.,40_.II�,.,-"i,.v.,,--,�".'J,;it,�,,:,,$-I,_-..,I,'I1;-".I1",-�-I,..1',_.�.�.-,"'-._,4.I,.,-"-.I�1,.."-1-L--I,.':�.'-.'",)..-'1.-`,��-,,1.....,�l'7%"-�-�.�I�,,�1;,f I,,t"%',7'�,,,"�.,.,k:�kI;..�ll.�!1,�W I,,-"!l.�.-I.,�-�I,l1_,�7��..''I".'_i,-",lr1".I I-�.,-r1-..,-.,�:,�,II' ;,--,*.,4,I".':��,,,,�I l�I.�.,,.',,.I.�...�,.,_".",-�,..II,�,,��I,:1,-I!,-":--I-Il��",,*;:,,,,.-,L,..-I.I f.,,"�4��..'.-j-.",,�,_';_.: .—;.,I,�:"-.�;.:.�I"..-I.�,1,",:..�:,"4:-t,:�"-".:,j""_._.I."!!VI-'..1�-.I.,L,_.,;,'"�I I,,-.1l-1IAI,,I,;'-.'��!_.�_.I*"�:.1,,�..,...'1"�,'"1.,.4,"-��..1",'--I�.,,Iw Z"-..I,.j,;I,�;-t.�.,�"I..��1,�-,�,,*-._,�1,,�.--,..��,'.1.,-'..:e.,..':�,I'.1;,-,-,:.�%.-.,'.,I.,,.1;-.-..,,--.�..,,.-t',1I1.t,,�'.-I,1"I',.7-1.,.-1�'i,-1!,',1,,;4.�II'-,1'T 1 .. / : I 1: sr _ t ' 't .ram f s. ,� r . I 0 sr h, -i~ I, ' t' 1t t �♦ . {;1 1( Il,•>, it s t -i C,ti� oR-14890E1e } r-,, ,' !".U7t rI_1�"'I.'�".-,�-�.-,,".j,�1,r',It,7,'e,�-,'-�,I'...:,�",.-'.',,,--,.�. 1 • li , 1 , ,, ,r ._ ' y 4' DESCRIPTION t;lrnf 1 '' '' /t I . ` R 0 THE LAND REFERRED TO IN THIS REPORT IS SITUATE' IN THE STATE OF t, ;, J� i "I YYe CALIFORNIA, CnUNTY OF ORANGE, CITY OF IRJNTING'rOh 13E21CH AND IS �_ � It f, .t .- 4 i `` 1t4 DF.5CRIDED AS FOI;iAWS : +'. ' i ! �' �;'` % `t i 1�. i 11 • 11 n p 1 Sit t:'Ifl^, '' ' ' LOTS 2ti AND 2� IN B[ACI( 204 OF HUNTINGTON BEACH A� . hOWN ON A MAY ,� _y I. ,"� ,r i 'j {�►"}" RECORDED IN �1001; 3, PAGE 30 rJF MISCELLANEOUS MAPS, RECO}2DS OF ORANGE ! * ' �, 'I `I \ i' --', ,•1 COUN1'X, CALIFOI2NTA. s,, (<,-, ,t + .r k ' A J - I`� tt >k * '� >} '�' S1 * S')rtl�'��y-•iI .' :1('r �'a {,. 4 ' ,` 1T ,t' J. ,7`t. .4j ' 1 xl - 6 llt 11 ir,,.l,, t. ; M•j t, tl 1 u. , .71� DLB: P. 1l,ly , J,� t1�' ` ♦4 1��' la , ' S?? PLATS (CC&RCS, IF ANY) ENCLOSED. ; �' '. ,t,'1' is f.�,;�t�, y,1# i'. -: t } ' t j NOTE 1: ACCORD TO THE PUgLI� RECORDS, 'rI?ERE HAV t BEEN NO DEEDS ''''` �` �s / "`/'' CONVEYING THE PROPERTY IN TNIS REPORT WITHIN A PE:tIOtJ OF SIX HJNTHS ,,+ t,-,'` ' � �+1i' t ', : , PRIOR O THE DATE OT THIS REPORT, ElCCEPT AS FVLLOWS: .. (" -,I', , -'k Jl tt 11 r"C`), 7: ONE. 1 ,fV i r �;t''r, 1 1 I a , ,fj q , tl ' 4 i 1 ` r'` NOTE 2: TAXE5 FOR PROZATI��N FTSC L YEAP. 1987-1308 y� ! J(�,.�";t I r r ` I N' f'I2.ST HA f .try# f ,� L,F: $?O1.�iS, PAID. , r , ,, yt ]r ,p 1., k tit 1, .A :: SECOND HALF: $.'r01.49, PAID. ,r!t 'ytlL>rf ' r t, _ CODE AREA: 04--035. t. _ .� .I r,. t t�t� •y +I Vr . '. ! 1� • tit�1� �`� ,ti t 1 ' It1h '' , A• P. NO. : 024-14 I—10• .'; �r L.t.i, ,.r,�� f t Z I"}l;7'. ' r ' ' + ,, S ' s ' L•~ �f "t�, 1�':.rri{>.1 .I•I...:' (Av� \ t.� i 1 f r'FGlrl��4i', 1 ( , NOTE 3: PREMIUM CHARGED FOR TITLE POLICY WILL BE IIASE RATE. Jtlk` ., J, .I , 11%'. w \r, t r r ( ' 1 t-i r`Q t':.r11 Ilsf cS� �,t' tr 1 1 4 f ) i ,� ' 'U '',, 1 G{ 1*tt r/j. ,!)I'`A''r� 1, s, ,. j .1 ' r , I r i r r 4,.a,,s•!It I`r' '♦ 7 ' rI y", J !Ii yl t ,; I t t1 i, r I__ ' ` I o ,,, , 1 3 t.,;I-, t t t .t{ �'. 1 j�,,4. I A I: r � .j _ . r I t� i A11', Icl- ,1 / r�� J��.�yt i, r .ts-i11 ) r ' y I I i 1_4 l« IM .r 1, I"Jiii. t rr I t f " :�i?.;L,-( `ri I I '`1.:rr1 ' iYj � .it ) J f frt tri.' ,1`, r `'(I `t }` tt'Y 1 ys rl Ij. T ri�//a. , y.�`L /,'1t+2. y"'t1 {. t i�y zlll I�it1 f Ir1 .-Vi "ti r( iit^ .. ''i t " x rl tf5 f/r;. r +r} r f ;,i '�� , 1+411 ,r<+1{t;4+rya ; 'ij ,. i , .(� f1. +t f 1'i t , , A,t+ t, 1�7t r tr/itj"f 'aA, ,i l s . .,ky ,.1I1i , ti:l•`, • 1 x1':, r� �-«r . ( //. 'v #I-1 iy.I-1 I,IIr.,,,l-.��Io,A.I'f,.".�'I-".,!.I-..%,,I,j.0,—,.�-I�'";..-;,I�I,,�.,.:;,.;(...I,I�..I-.,-,*-.,'1."II t I.`I,..t 1I,I;.I---.0,,II�'II�.-..k,.j n"1;.z-.,I,1�7.,I",....�..1,�I1,:,I..I I-"-�_I"',�I,.�.j�_,.I�;,4.,,-�,-"4�.,,.L,,;.I-,.-o II,"-,I I-:1I..,I I�.1!,...,.-,II I-'..�-I-,-.,I�.,---�.,,.�Ii II;,,-i.:,,�I.-,�.I.-.'�..�".-u',I....1'I�.-,;.j!t.,-;f1,...��I.III I._,'.,I,�..I"�..,.,�.I'�I!..%�-I;....,".�—.,,..,f 1�l'),...,,.i-...��.,,,'-0 ,��.,,�?-:.."I,.,.,I",,W,i.i,,,."...,-1..I1.,6,..II,I,,['..,6"�fI:-.,�...I,1-.P..--1�)o I.�"1��A,1.�-1"�;I�I',-..�I,:!.,-�I,�",.I:-.I4�,I, �1!I,:�"'!'`_�t�:..I.':��-..,,..� t �i.W:y,, '1 -e I 4;) rt{ -f j fir r L,X JI, .,r -, `•�;' ., I 1 ,/If it Si' ;+t t, PAGE :fy't 11,1" i 1 J' •i� L 1, it �iA�A�� •` J�f f�) r ,•rt ,:It •. - lii.lrf, ,v7 ;4J�},31 r I,-I-.I.',,,I.I.II,,.I%I�IJ.l,_1.,.,.I I.I,.—I.1 I-��..1 II.,.:,.�..I,-I I(-Il I�.1�.I". ..1.!.1 I 1;I.:.,I 1.:%.� 1,,II I.,.I..I.,I...-..-,.-.�.��.II.:.i.�.I,1..I�,I.I-I..I.--..,,.,..I 1�.....,,,1-I��..:l.,Iri;I.,.j I.,I I�'.,.;I.I,,�,I-..,..%I.�.�.,.1"�t--.0 iI1..,",..I I-,,..��.,-".;i�-1-.�-j.:.)�I�f�,',.�'.,.I-,I-i.,.I,.1I�iI...,,,I7�,�.�,�,.,,.,k.I....�II..,.�.I.I.tI,I-I III,i..,,�I�-,4��l,)�.' I I''1,I,,.,��,....I.��.',""4�I.-i,I"�I.,-.�.....i;,,�'!-"i I�It x.,,:,,._I 4�1.�,'%'.,,-:.��..", - I Y1+{i1 t . 1 y 1"'t t uY!t% s r, f iyl '11S / r ` t js*y�ir , ... -,R�Y/ x4SiStr� �rrf;, 1` ? p l I t,!iy I i '1I' ' {1}1tr !�Jy t'�i.'r 1f� 11 r -h , - + /t) try ,rttt !� #., rc i i r.' t l J .'• 1 t \ 1 Y � � r" ,! , , Lr'� ! r.rr . Ir ..� {7 "/�' - l4 ,J! ,i � 'f F .(, ;tl rl •• ,i11' ]p f`�I i N,vn ,t r� I,iv, w , J,Z. f �,.. ••. "i, � r wI .,f. ) tr•k. „DI 4i�7t r :•I. e'q:rf.L'Y�[L�ir ,'• (N. Y.�t},'/ `axle .�'a. '("r 'r31"r..,,�1: 9?, y i ''.., `r 7 ,� rr'� S` tha'..•r /.. .`';c- Sr rl _, ,. , 2.:,t ' , 41 •li I I' .,,, n r i'. 'i- t`y4r fy:e. ; 1..1:,.. �^ ... ,..fir .. , { ... ,., I , ' * , \ il.. /, „) 1+'::J�f.•.!f�r,,/ )'''.'. `,'; _.. 1 1'F' 1 o.L), Ju<.,, .,.' ..l;..,1 �,r.:i .Y .,r. :'t. ,1 t' - c ,f '.i.,_ , , I' `,!`.,:.. t'7 '.', '' '/�♦� rt�f•1�1<S t' +:`C trl .,I,'..;.Y .l" ,.. r ;'t' •,ij •7 .,:•,r, tk. \ f ,,. j .�rr 1.;.. ?. '!r' . .,.` -4.' I t;... -....:.. i�C.. .. 1 _ .";,, II r' ( •1 ;•t " F 'a ',I� 7 R g ♦ „. 4 3�':i. .' is ,n, ..ri �.,. l.. :f,. :'J, iw (C l i.i tt(( II: )' t I t; aA :, L ' I ',4 t t.- t- ,y dl i 7�l`'`j-tI: 'c r� a-. , I t� {t rt rt.'1� ,,l 4 rr'"h' ..t,.,, y -t h { ,. H• ! 't): ,_,. , I•,,. 1. •�kt ♦. '' r, , - r.,iu 'li ID1 I'" _ tt s ,1: / 'i. /'a .0 .r, r r 1' ,: .lr r. ' i' 1f I t }' ,. -tit ,:� f t.,, ''T) 'v �x:1111„2 ,.-: ,;,(„ ,J, .. ..� ,j €' 11 t1 • yy11 )+ a iiJt t,,u ,.',r.Jh^f �" N *1 y y �j� •.�l1 , •ir ,.1;:. r rr, ,',�, - I �'' i rly ' :�r' w, . ^,.it S �; y<"> ,. .r, n„ .� "11, r1 .- .1� ;',Sli n 1• r.7} \" .r;1C ,• 7, ./ 1 4 1 I . /1 .r}^�': 1F.::' 'rr I,j ' ti; H r -t ''. `, ",lT: 1t' 1 \ t t r 4 �J * t. '. 'tiS.t t� ,.', .I,._r/ I , �,_ r I. it 1 r r r1 ,:;;,{.1p�',1�r +:t• •j Sr I h• ri�r 4� 9,-y •'/p: "t:✓ t 1 I ,.♦ ..�L.,,.l .'t' ,; I. I 'r.�J .`'/ I 4 C1. t;lr S}..A' .. '.n !'t' + . 1 �_ ir. t/, t..t:.'i 1 ,-, ! , ,r , ,!•1 f .r i� I v, r,.t ' i 1�i , ,. JY'• �1, `!'ll rr tT'.. ,,... y. - / r.1 •�� r ,�' ( J"', yy�t)1 ' I -S ,�,.! R11'r .t t r.,l- ... .<, '�,v.,' .. IL � .'J '•' y•< 1 .`Iit � � t, h,t •t 1 , .r, ,rrl i,;L .1ri'."(4,, k -� r .: I4 YL'S.( , q, -. ,y. I.: I / .r ,..i / .,,Ii t ;` Y1. S i' ' t:'1... . I, r,( .� i,. ,!' .�' '� rr�l:r!'?, p y;.,: V+f !,t :'}: - ,t. i Iil 1, i.l� 1•� ,.1'II t Z4 ,'.•l. •r,.::, !t. -,Y. t.'f I .;i.• ,ji 1 t;I �, 1 .!• ,1 . 1 s .!. lei . �Q .rt 1r i [ ,, r 1!' fit' 1. ' (' ,:I'/ iv ;i1 ,rr: r ' +`•C'A ?. :t 1 AA4' ,,l,d' , �.{! ,C t , , '.1 :I .r. ,�\`. .' r r i1., f 1 .}11 ..t- -..ZI' H..i• 1 1., ." "r.:1 pl Y.• II &J."'1/,1,L i t f rI,l 'l.,:r^ \\" I.. •�,; `+Sr , .',' :/ , , N.t , .. „r:• / _�'1�. r k. 1 1 1 rI Tj• YL . !•; ,'r ,,< •. ., 1-` if ,1` - ' •.,.., 't. i{ 'I. .-, - + l L ;! lr,. r• .r F .l I4 C.;., r. ,.. f i t r'.; r xr .i";i y• ( f r �,-- `�'r t, Y+i; ♦.,.. •..�"f ....' :`r `.1,, ;;i' ,h i. r _1.. f 1 .`f. r .II t 1• f s, l I t �'1 ..: .,..t.., ,.. ::. ., ,..., +! ,-;, .... �: r `1 ',i .); r• ';'� r1 1, , ,.r)..p y,. tl y' '1;, .'!,z , t. .,.,.1 :- '�.�,+ 1. .1 1 :c ._ .( , r. ,t R •r ✓I J ,j,I. .,r�'':^.{"r + Sl 1 lr,r 1 y. �.. l j{ r . �.. .0 �•.,.1 ,y .,.,, y ,,d,i , ,,.. .r ,i , 'f, 11 i ,�1:' •1' 4",,..j' 1 f. .!' .( .�, N{, �JY r. lbw'. .rr „ L I� i �L ` ..,i..11 .•,... d, •..:"; '.. i.. t 'i�t.! i�r,.,.l• a 1� r. 1.,.1 _ .r. .�". 1, .y�.r. l .,., _ !k" f,Q'1,:i . :((r'� :....r „i ,�,,../. , ,,,:.Y` ( +.j:.., ..) . . r.•J:. y': act+t' r. . J .Y, . 'I, "�. (q,. +r.-., �,1k!aIS:R.f,.<. . ,. , r..I,.. , ., .., .1?. '•J" I ) r '.t r )_" t�'. I .�7t t;: l 'I .«.. r r ., m ,j .:._r :, �r;•,� . .,. ;',, -.r ,.!- , ...;,. .,; ,'I'` .w �y� /ra. rr `.a'1 y- . '-r,'?,^. t,ti�q`... .,.�•,tr. ,,1 , „1 . , ,�1, ,, '•', - r _ ,fir,... .�) ,, kk r� il' t, .S :;r ,.�,. ,, h a,., { f1`y1WM,V t )t 1ji f,:1 'c 'S ,. F.,. t .,;• •r.,,l. `. !1.• I , •;a_t,. , }' ,'1 y s ,� ' ' i ., 1t :►�li r t4:t�y rl i .,..rf(..fA .. �''• ..•tll+t, r1 } 1 ' i ;•! ♦ u, 1 •'r• ll' tr. 'r-r,r_ .,1n. ,s _ ' r ' • I } q r[ 11 1. a� ' r� � 1: •tom , • 1 j- 1 r' U 1 Jp IV + \ 1 ' : r •i ,, r 1 r t• t f. .. 1. F : l i_r - 1F •1 y „ . .t , • I 'I 7 l I IL... !� �1 s��r rq lyl��rr fit• rrr� •r IT e Ir ;t`} .l I r r,,l �, .''y '• ,� -. �' '4_ ,'-: �� #�}1'"r'yjltr �, t.> 7i if �� y,i�Mr `y�y�,y re-- y, LX9�YelAt JLE•Y.QSWYI if: 1►ASC.L3�. '!r3•..'4 �� i.1..' it:"'L4r��'�' ro...r'�.i.� :►tc�..L S .1i1ssSa 1 I J ( P:,.9 tta�!1C'ltitif�ilvC Ls:fr ri .+.w. 715!>titYl1"c7QN. •, 1 v , , f '. ' It r . s• • tG<. as Aof 3r Il 13 —sr 9- I. /fie. t �' l N nr aait•+ tt Are o t� f l Al'£//r/E OL/VC t 2 ] _ 14 �w 24 / ILI 9 ,1 :` •' zl l rEL WILAur AVEMr > y' �t `� I ArA/tt�/19t I HUNT/;rctThrV �'_' GN•�l/N.3-J6 �' 110r •-ASSES50f7 S BLOCK A ASSESSORS MJtP PARCR NUMBERS BOOK 94/JAGf 14 ,t f`s 15} SHOWN /N G/•PCLEl COUNTY 0i ORANri rt 4h, i3 It ff�LD ,', Mail is Ul;I •�L� yy1,, t •e r'1.7'/.�:ieZ�7S•�rrf`.VRGsa'a1��wu+.�++..��w�+.-• :� `.t 1' t.rwr3 � . .1-. 1. ,' 1•IJ r.,_-.., -,,. n t •,I. '!,Z jI [:,.�� :a�.. tl^� Tl.. 1' f •{ :1y�r`}rj+ '• Y`,,'Clt 1':E':7" T��. '^*i 1i ��y rr� , '1��' ,xl'-tl: t�'. :..' elite .�f;•�,'rY �•1•' . .. !1 :1' '1 ) ,�/'� 11 ,��'r: �,�� _4` y' ' tr t�M .r , �ti.l (41tV t/'iw' .1 `ti tr.J 11 (1 t, • r C �] t 1 p .r., ' • r,l 3 , -.:,Y p1A tLL li.,..'' *1• '�-'1/-, , 1 ,..: '. �i,.y1 �.;' :I I (:;fl ,i`• i.� t JI r.rT� s+�.2 tr�t: 1�1r.• h; r.. .. Y ,.:.w IFI:.,.. ':..r'..J :_• 1. T ,�� I �ds..t. _j • 7,4 r i. sl l�'r,1'! •.r •.r t,,I�.:..j , ... i :I�:. � • ,.' o. •r /r 1 � -�•�,1 -1 s ':,7. ..,.tJ3l 1 J..., 3 ftp:.:-;.` ". -.i ��a;. •. • .• ,. . . ,r, t ,1 _ .r,' } t �.- : y�\•' Elt� 'J,.CI. ��7t A. ,l I 1 :l 'jot' '�' 1 • ''r. t.j Slr "1�;3 '�'ty:'�.f yl "�trFi it ✓r1� =.I r,r;r, ffJ '' ( j1'tt I5 t , r , : • �"I.1II.4I0I,��I1r�,IIIIII..a4f:..�I.�1I4 I;I II�.I;!i > J-F }jy _� , f !t _ II` ti i,I-:.,Ii),r"�,. 1 'j �' t . 1. y i .i1't � A ,.,;t).�,-P�,":-!-.i-..,�-�1 7.w,,%I,,-.,,-�".1..�i��,I I.,I.l,i._"-,-,_.,;,,,;",".II�.1�-_�.1,4K.-II.-,�,'.,-I.1.`_I�.�.,�',:, I.6-,'.",._,l-,...-,_.6.,-:L L',,.'f-.,,,,,6,,,,1-,1."�',...,1.,,.�_,--_I 4'�,�:-.M.-,-7 I.I,'.j�'4,.j;.---.:,."-I..,-i�",'.,.,,(I�,,;:�I..,.1.11,1'I.,-�I II��,�,"iI I".i.r. -"�:-.�I'.-��i�-.,_..,,.1i;-�,-.._'!�,.Ii,-7.,.i,,,,',i I,�""�..!..,-t,-.,-,II,_,..k,*1"1;-,..I.,,Y,�.�.,,j.,',��-I-.''1.--,-._.--I!�,I,-..,,—,.,..-.I3;1I V.�I-"-,1r-*F.,iI,�;.1,-,I::.1"..-.��0.Z-.L_1,",'11�..1',;ol,%-."I�I,.�..'�-_It,-,�'I,,._."-�.",-!,%I�.i.I 1,,,ji-N'.1 V,�,:�`�.I-"_�,..,O.1,I,-r I;�"_.,J.:_��.—�, ,.._Ift-.--1.F,V"`7-.,1;-1.I,II'Z?t�,..7-�;�.,��.___.I;.-...1�-...1I.,41�,41 j."i,r�,1..,I:,-,",.',,,-.l--,I��..l-- -I.1'i-,.:,,.;�.,�.Im-I�_'��q I.,'*--_I".,,�. ,�,-'�,-I.��4 A.f�,...-,I" 1-;4tI,'...�4�0O,,"("-,A.7 A t-.I 1m..�i..,��.,,-,'"'f�1,".-:.I I.I,I,� ;..II�:I.�..I�,-'I�.:,'.",.I.;,I�l..?-II...!-.,,�,.,., _,,-.I I.,-...�.,..I.I::..,�.. —..�,�.;.I,N-.,.r,,-�.'I1..,,,.�,r...y�--.0�1-`I-.,..,).V-)t.-,._'.,��l,,I�;.,;tI..,:;*.._;,I I.�-n I,,.":.l,..:;II.-1i."I.....,,.;.i-�.,..I,-,,��;.,l_.1.I;'".,.-. �,.,'.i,1"�.,I.�I%�.I..,`t.,c..iX�.'4I:-.0,I,-I---I..I 7_I,,.,�.-,, _ - - r,y # ,,wi t 1 1 Y I t .�/Y # -, !. p 1 Y r /-f ,: 7 4 , IA, 11 - ,_ - yy y r I I . ;, .. 7tr. .. 1 .. , ,, f -. .: 1 i • �\ r •i(- t f V ',l` t r +� I S �.., , f 1 +. , ✓/, f./ , . , , ( y 4 1.rI j, , `4 1 t' > I? ! i y 1� r� r tl Y► .+.- 2 37 t• f li , II , r ! 1 z (fit -I,' fk t.� 1` li 1 1 s,. i I_ } ✓1i j} '! ll, Z -l.t' C7 ,. , s: i t; iY ,,,. ,.y"e ,` }1-{`!rf '`x 1t�4�1 ' ' > I` t,7f I . ,l �r ; • ,� ► ;aiY i A,.,.y 1 S; 4, vi, , .,e ' ,;. " _. `,• L,. + �ju��' �. ' f` .... ., 4 .. . ._a>r•:+�". , -._13.a.i.a.. . ,'._.,.:•�.-a.��<n'l• Is •1 ,,,' �,F:+.:L,1 ,L',.r r..,,.r «4r,• ..,...a..,�....,..,«. •I. '.~ ,r t, ?11 I. ., 1 i )., ti , i',1* r,. `!r q tI .fit t 15: ti 1�1. +.: y ,I , 1 i , •• ri Y,t,,I r=`six`` 1 t ,ji1 I j, i I r' C ", f} tT ` ' r'` ! 't I ? _ 11��T1C� 1Ii, '` 1 9. o r kr ,i / .f'r,i. f: Y"L!L, i r . f): t {t , c L' (� '`'�, ,t i. '' Sections 12413 and 12413.5 of tho CaliforniwInsurance Code become effective on 4 ,. •i t January 1, 1985.This new law requires that any title insurance company,un(arwritten t'Me j . g r l, ' `• "✓; L.At;ly Pt" company or controlled escrow com an handlin funds in an t.scrow or subesc ow ca cl 'V`" P Y 9 Pe .�' tir : : t t!(i` must have alb cash/ checks and drafts representing disbursements to be 'maade-by It ' ��r,,:, ,�1 V ;,- , } if ` a ,j�•�' deposited into Its•escrow depository bank account beforo recording your transantia,i. ,` t•f"'�J ', k'a' '` C '� L 1 1 , ', Y, '•M _ . Whlen checics(including cashiei s, certified and traveler's ch©cks),'�dhire drafts and '' i `fl � t v ,-_ > ,ti1, money orders fare drawn an or issued by an office of a financial institution�oca�ed ou;slt!© �' L}ti �i,1 Z1fi�L'`t I1 _ - ". t 4 Via, (;.1 f ,: the state of California orwhen ar7y drat:(other than a share draft) is deposited into orsuh- ; ,, t . ; ,�� ;., i, mitred for coilsotlon to First American Title Company's escrow depository bank account, � a,1"� IP' 1' ; Y{ there my r be a substantial delay in the closing of your transacts m or the disbursement of - •. O, , ' tr -4 i ': 'wil,' ' funds to.be made by First American_itle Company. - _ �I'r,. ''V+f } r ;, a,{_s • ri j4 r; t : To avoid any delay necessitated by this neW law please consider the following: _ ' �_ > ' r f `.;, d � " ;I/1 > _'' ... .. _. - ••- q t ,,f"Y Ii ?.; �rl 1 r. t �._ j, '. 1. U e checks, share drafts or money orders drawn on or issued by offices of fin ncial ;g� s rr+ " ,r ;).,I,1I,1 I.,.,'1,.�',',--",:� ,.,. "4,V, 0 ,r inItIltutions located w;inin the state of California .. ; , ' I U ,r i ;-' %- + l/ �� .. RequirethewiretransferofthefundsfromtheoffIceofthefinancialinstlt�utlonlocated +f ' '+; 'K,tryP, ' ' q outside the strxte of California to.First American's escrow depository bank accof;�rit. ',: ' .t '", 11, `:•, r t �.%.-,"-�.�i_,1.-, 1 .� r.. .,1 N r r t1• � r (: r,je '' 3. Avoid using drafts " < ,_ e t , r ,�. ( ' t ,E �, i + 1, r;'' �`./'��-� " ` ' •'' If you havo any questions about the effect of this now law on your escrow please�c:an-`" •� . , ` ' `F�`y'.. _' j :.I.:t r" , n 1' O i' '•t .�'1xr ` j t� i,�l it, i,. _.��' i 1 . 11 y - f+ .•�, tact your local First American Title Company office. �,� ,;y_.+ s�� ", ;: I, .$ , }:.;. 'L} f'4' ''I y.. ., 1 I.-( . t�r•SYs wJ� { T�1 L ,,s' +(r I i ; r4LJ ° ti? it t : �: , x' ,Ylf, . ?+ t r , ry' jzi I rr , j)�,4Ef{r s!fir I. 1Cll l,r, l e '/ -1 'Ly^ *ixa t' '.Ir \1\r,Sr- r i <. 1, ` rt. a Irj .w"titir r1• v, yc ; , ✓(, , } is ,:1�k1 :r r , 1 � jar r `�A-fi t x ri1�`�4 j �1 a � x. 1 r; r r , f J, }! Y tj , ,I, 1,I f ,L,L)*. S., 4`9_' , Y J. ;jj'�ri+ lif l«f��., .... 1 .g h , k,A' 4�' i [[Y I> <' .^1,' _ -':. ;j '[�.u�A,' tr`��i��}t.T L + r �t /',1 ;� k' r l ,1 SY , r - ' ,2 M :' r" !i i,rrl l' .,: t r' ( { .-" .wrw...rvr reJ�•r�ssi•1S.Tt f' ,,t,.• :Yf .S \1 /}l ,--i i ' 's 4' ' :j _ t t:I 7/ �' r.,,ir. !ar' tr:.•ntr- .il .._ '':-,r, . ," ....nw.ra.a_.r . ,, _ i. • r-.r r^.a 1 r•M `I• 1 .i- '',r 'rs ( � j'•:,: ';.: •...1.•w,n..q.er.•+ rw ,. {. ;.r t.,,, ,mil.'= - ..`, „':.I l: 1i :�i.I 1 ' F „ '.�J[�•�., 1 h ,, • _i ,,, , 11. i., ,• L . ! l 't y. :! 0 ff`. .5 .I,, ! 1 -,..I. ..,�, ..i , T. ,., :(' ', t• ✓. n'`-,�. `• 'l•i tC + Y,,r,.: .3 i ,'t +.,.'a .. '....: i ',a : ky .r .-. 1: 1 it I} , ',t ti ! r r'.. _ _ly:e,:,, + i _ r f R(E i ,I C', • } A r .,,t,?. '., '.,•G " - ,., . J },. 1 r;I F, r i �� i I 1.r �.f.a3•y', L L, a,.. .,'I:..L =-,+.:,_. .. IO ?i7,,,., :-. ,` - a ,`r .1' ' „� r1' r`' "r, rr....., ll -a ;,.., ,�,. ,. ,,,.., r ,,..., +E,.;,. .,, .. t , a .�' / +,• I'0 1+It� .Li:K' ''i.-� } r i' a t r f '> >��: 1: : 7 :1,, rr. w.,.� l .{ �r rr 1 t rr„ •'i CI t�t 't r'� f f V ,...;f' -'"A- .e. 1. I'_.. 1 - ' . L ";(�i"•-� t r ��'}yyyj....j+r (L, 1' 1 }•f.i.0. `':.. �� L. 13 ..a `i ✓ !� f f ., ) t ( �y r.'r �i k ifs 1 1 -.L �' t _ ."-fir . -,.. ,, ..r.` �e 'r '�`. L !Y•'i 'l. YY ; S I; t: tE '• ..'.::.�,,.r >7 �,.T' ._(':-N .. ,., :'i.i ,t .. :/r....1 it-. 'J -41 S ,r' .1 ;4 �" .,,=, „a,i,?" tp..�. / •IY ., .I. , I':.. 1 It� r }.. �f i ,. r i ,•r",� ,,,..,., 'I`I .r f 1.. .� i i• ,. • ,, .I' ,,.'• !, 1i 11• tf 1'.Y ,i fl 1}`+ >).,tl.,r + . •! tr __ _ri e(.,. 1,,,.. „,.; t :, '.':c l• :( '= A U. r,' ..r�. -. i� 2." +; a, ��i �',' ,t }} ..,.r ,.. 1 t. �,i.. ill. 1 ! ,j, l ,' E. r^ Y 1 A, .1,-.1Yh `(,; L FS ,. .' Y '"+,r,.(' .i `' •sj' {(��,. >'( is.ln.• r ` �.1 1 ,J.• _ .•,.r:I , , , tr.,. ; , ', '_:•. :r _ 1`t i .�,: :b ,i71• r• •i" « its:•{'� n 'c-- -", ,._.} . : ;: .'., .._ t c .i1)•,,, �vj) ii,i,�.,, ,,,, 7. .(. -N ! -N •4 :i -_-`, 1ir1L1 er?. !!' r" t, fir'" ':a "n? !(':, 'f at y ri•Y ✓♦ .S t .,:,l f" ;'!I.l� .t'.L. i t :, Sy.. .}� +' '1,•. 'o" i,,. r. :{r�.l �. 1',:::., ..I i r t S'- L,•�. ,•r: r..t` p.',�-;�,.r a. /,.:. ;�1 _�,l I SiT.•�•S•t�Y` .t.,yryry, M' G.� .� ,..:J.. .,.n.t� i 4 ,t:.,. ,. �,t Iv :<.' l..i .L•�x. .t .•j t.,Y ,°.:L'�h1..:;t,�1x ^. '' ice• •.. ...;• •r' ?.'J l�,`•:>/-, j•.,h..r' .i ."( :j t -v..v il.�' . •I:.I, r. :1Y t };. t 1 yif .t 'll :C'1s:Y .tr,l �r'F. ,:" ,; i;,, _.,_ 1., '�. ,. a ! ;., r, i y >' 1 ,=i j'O 1'r. :,. ,,� r ';il,•l(yr �,ti- �_�.r_. .�•'•;-r,.,. r•• :f- ..,, f� 1 , a +6, :+►'• ..I,..� > n '( j1, ) �' .. ., ,.r I�i 1,. 't�. .,...i ,.. f:. .,y ( ' 1�"1 ;;. „ , 'r'1 .- r' :1 ! i.j �( 1 `2 3 Y . f I ? rjt, + [. 4 r 1. 1 . . v ? !' i.i)f.ti� A�Iy r, `«9 tt'' , j P. i "1t ,. t, ,1 " ,. .`,", , v f= �c' ) d ,ir ,cl !'1 t' 4 r a' -.,i�i f,t.. t -, I .,(.. .,?•_1, .:� ;� '-.r�• " �i ,:r;= '� ,, Irty ✓1. 41+j, (1�, i•',,l,;.i (. i It t'>• `- . .:.� , t ,Cr r` Zt t t •4{l'� ,' 4� 1 ,�jy.•rFr a.. ! "4 . 1 'r '�i ,.y. S .•,�1 ir,' f ''t, r . l �i`•,�•I .I I - w _ ]x I •�Fr !� _{:.;1 it., .,, t t y' .�a,.,j ri �i ' �r-1''1" 1., 1,. j ;4 1 �1�1 + r, :>�a�•> �� , . L. ,��i,�X..� ,:N ,;,i r ;,. ,! � /::. r` f , r �`'�..' 1 ": .: ':.1.. f. i r .r,, . � r , • .. ..,i., 1. :1"u.., (. :,..,, i,,, 'IJ ,,; 1 .l. I. ., " ,,j ;,_, } A., ., 4jy. . .. 4 .�,r�,lr$/-.r+,+a/.I+ri��...r, nl. ,.y...,..).1,. , - i", ,� 1 1:,Y lt, , ?, r .,:i.t '. 'rr:ri ,Itp iF I j ;.i? , 1 ( I r; I. �, "' ,SZ� �11:t. �, •f,} t ! . _ r�1'J$1 " t'r jr1 Ti r tTi ` ,i, , yi';, .. .,:Y .1 t,.r.. I ...1., , } ...,..•'1i a r: ,'f ,1 Y:• F' ,} rj ' (f,,, ) ;>'I •_ 4 77 I - �• y GG O r f t • ,,> >.r.yl. ...,.1, '. 'A ( _� _l IN 1— ! ,� ) f,: n'ti•.+:, ,?i'if Lii"!�'h, V z , '-: �t •:(•.,;,, , .1�'',i ''.n)f .• .a.. , .t, rr :{,,. ,:., : :. , ,".: }' ,..,;•:,1 'j ;.i`' 14..,_ .'. ✓ ' 1 r Kr: _..ir, t .1 �_. ,', 1,:I ,rl, r, 1:• :" '�' it : li d_ f, r�fi ,,ytyr_:,,_, 7. y .., « .. + r .j,R' , .-� e'�L1.,/ I . �.., f t. I,. r i•.�. , �.f' •, I. L,...,,Vr. - 14� Ll '.i 1:i'�C.", .:r .t� )/ -" , .rf ; .✓.,;..;. 1,- ... ,,, ,, l..S ;i:. tri 'Ii, '.f ,r.. ..:, k.�., .ltl .'; ` . .1l,.i ,'.,'1J;. ,� Ir , ,,. ,\ .Y.I .� 1 t wal :Y it.Y .,, _ (-. .. I ,, , ,.` y '.,._. i i, - ,f "1 t)`' ' ,1`• i1Ij tIl ...{ _;e�..t .:l'• / :-,,,r�, .� .,Ir: ,, ,,, ., +, t' :`,::1 ..+ 5r t11! ,+ �,, - II 1 •. Y �R' , `"i ,{„ l ,i .n •i ?t*ref.Yn1},tta - 'xt, r..n. •.•.• ir.::. . +j� J.V l4, . ,, .t t`, .�-a :t ., •:;�I+, ,ii Z - 'b t r i. f a 1 1 r. �✓;r 1 • r '. /f ,'�F � r .1 r -` ,+ rflt� •t t l �� '\1( \`•��i t, t r A' '!' '. jk4 r•�/�! �LI r It.' _ 'i, r S �r i.« �� /`� i.Yt t ��'�r'n, f ;,+ .!<' •-,,.� fit, ( f J � r I r• rt { � r ' '-'. iL.--, i 1 +ell r 1 �+ ' 1 •' r I !' { 11•r[ ''+ r � 1 II 1 „ ,•,-i` �,' lr. .7. ,, .) -...•n..,..�l,.ti,.. ...r ,.. _�. .1,+'>. .. ,.. •��, ... .. s:r. _... .. O�. ... �,rh,....,. -. •-a. .':�'':ra...4r.,..•l��n ,rll t f rt REQUEST FC7 REDEVEL0PMENTr--i(_-3%E}-,'-ZY ACTION t�•'� , t li t 1,, ,r i !( ' r, V Rl•I '' 1*�: ,+ '"• ,l i r�, ,llr Septembe 38 Date ,• , r Chairman and Members of the Redevelopment Agency 0 ,••� r �ova r: = kt, Submitted to: r / Paul Cook, Executive I)Irector• 1/ - �" ' �� '( Submitted by: Douglas La Belle, Deputy City Admir,mrator/Eeonomlc evel}o�iSe } f} r i► t.; ., !i i Prepared by: AU'fi101ITZATION FOR THE ACQUISITION AND APPROV r6F l RACT Or.; Subject: SALE FOR PARCEL (APN 24-147--10)SHANDRICK i, tt ..(�} `� E'.•S'! - Consistent with Council Policy? j. Yes ► j Nmv Policy or Exception Staternimt of Issue Recommendation Analy0s Funding Source Alternative Actions Attachmenw, rV i .., li •� Qua{ `t r, li•., ! ..! f STATTI�TENZ2C1�•£I : 1`� ' At {i •,,ram +I' V � �t,�� r,' tit•'-•' 3�;. The attached Agreement or sale is In accord with Agency action to pue%hale properties on .�' a willlag-seller basis In the 1daln-•IF`ier project anw. The att:,rheu Agreement of Sale represents the purchase of a vacant piece of property by the Agency owned by the Sylvia tY�1 Shandrick estate located at the southwest corny of Maln Street and Olive Avenue. The Agency hap previously approved the purchase of this property. Modifications to the r tl} ! " ": ''"' ` contract have been made b the owner't. attorney, and those revisions hove been agreed ;lax I �• �- �t; y y ,r •, �" ;! upon. All warranties have been eliminated resulting in an as.is purchase of the site by is{[ ;♦ '�" �,. 1: t1�a3 Agency. >� ''' +� [ : ' ti\.i• Au l3 t ,`1''�'t i+,^'•�'�sit)11: � 4 the:•i'ae the ext•cution of the revised contract providing for the acquistion of the Shandrick property (APN 24-147-10). Lots 25 & 27. 11; �r' r%��+r[(i,+, ` iI / ANAL MS: I ..zt Agency authorized appraisals and negotiations for the purchase of properties on d ,} tilt r willing , • . r1r.;t� �i,r g seller basis within the Main-Pier project area Art appraisal was completed in January of 1987, /and updated in July of 1988 reflecting afair-m 1arket value of$323 000. '• t �. I} }r fir �) et' We are recommending the Agency approve the acquisition of this panel at a negotiated price of$330,000. The additional cost will n1low for the timely acquisition of this vacant ct j niece of nr:Jtlterty and facilitate the irnpt�'mentatian of several Main-Pier projects, {r' �' `�`5^1' including a'Ir Main Street second block project. •' + �` � + �it , ,�T 'fir 31~,��•'!•4a. aA1N Pit " fit' !'•►3 r Acr•c;nt No. 812601 • f sAL AIM ACY70N.- ,•` r i l t ° t Do not approve the: acquisition or modify the offer, { i ` J AUMM All t Iq 1) Map of Property 2) Agreement of Sale s �+ T 401 ih r } , i lb , t a 1.l rf{ '.:: ,1t?9f`•7.c• ,i, i.,!(ST^ ^^•lL•, _, -• ,-. '.t,,•-. .'r•- i.} S. ",: ....,� n.. .,. ... /, i ... i . ''r., ,r.. .. r•,. ..'.. a ', ;' .. .' � i ( �i,..."•' „rT."^' `1. t:-'.r^sMr.. �, t ,. .. ., •, ..,;,:.. r•`, ,..', rf ,r .Fi •• i .., ,. •_�', .,. ! .,,...,:. , 3t.tie.. .-.. I' .' 1 •:'!> �� -.f,, '{t+ ..� r , i C•tY -'�''. ,;"••!.7.�.,.� , ..,�k:•; _.c,, ., f �„qlr �,,f,Tr t,.}[,.+•-.,;:ti,,, t at<r• .rJ .};.r;i r � .. i . �. i.+ .r z'a.,,,� ,t:'a.,...,('.� 'T�`.ir li• .t' � r,: .{.`[. , ;.:,,:.•"r, •� ,,, j. ' ,. ri•� r '[ ,,.., fl•r�[ 4'• .tii{,t:'t,� .�i:�"r I , i�` '""i, St •tV�` , .`Y' �] '' ''ry l��+r ''.. 1•I F.'> 11.1 ( , �i� t ',� 11 ,�e,'. Wrn i '.� ` !t, 1 ' .�a• L. Y .+►f.5 .7t>.. '•.,t. [t,'[,,.{ !". ;i `•\+ - „ Sri f%�' r> r} _a, '`.� r�r ,r. [. ,'µL_ , `}I +• - � �' t" ;1 = >1 �'.n .��; ,.>L a clip .t ;�? .s.1 •I. i fi�.� , ,. ,. ,, . ,.•. . . ,' ?:J. ,, =. 'Si,.SS,'� , ..•, ',;lee _.,. ,,.,., .. Cl,.,. r'r'•�',. ,� �\� ,, '} s,. + ` pf. F",'[,.E:: ,'E. .�,. : '11�"'' t?.:CS1 +-- g,t',�1,. r-,'...r !. ,. ', ,',, , a✓ �i, i � ',J,• - ' -' >, r- It. t '. ,,, 1 .., ';."!.; /r -.'• -l',ta: •i- - '. r:r' ' } t..f, ;'r'� [ .i t e,Y. r: G a . :.,,,. jeer . ,: . I+ ,; .. .,, ..., •/.. . .,:, ., !, �� !i ! •'iIr �r,, ' sf 1 . •t. ..1!i(:' , ri• _ ',, ,. t';, r+ .[ , [ mr (}- 1i• ff h'�l%i•:).`j r , . .} l r,� r ;u, i ,ry,, � + ., .,7 ;:;; .' r.'. � •}. `r� r' It ;z�l>>.,`�.2' �.t`. Fw Pt,t„,Ttr[i{• ',r k f ;,tt •', .ty'3 +,, ,; [ !. , i t `% , ;}19, '., ((jj,,«, r,. ,ia'ti:..! , •'!. 'i r 2':'C_f' t t ;f+r at: .r> • jFTI SJ •t,:,J{..•1( r(:F'' ' i 1 .✓.. :., .. .. .�' i,i t ,, •t 1 ' � -.. t°'l R,, 4,' {F ! -,•. ,,}, ,1. :;' F ' 'II >, ,'. - - \ �.! �� '' 1 //1. tG. .r ,,'r f.,r,,t.. f.�(• 4 .:1��' 1: '>E - { ..t. (.•1„�.• ,.,. , `t,.. , ....�; •;S>... .. - ' '} , � ., l[( f li'� +,,r � i )•,1,.'1lla, 57 : � �,�.,I ,11 , , �:,; ,,, -r _� lei:' '� 1. •.•. �'; .� fy;}as <; - �'' ,. 1'. 1,! i. .r_�`S 7:: ,l,,f.. ::, +.�f .,,,: rj .?,. :.f'.,. .. ' ' ,. '- , 1.',. :Z �, .�•' , e. irti[ �"._.��..�•�•4'f^••! i' ,.t .3 •t.}, r,. A '1. ..+fit. ..1t'.i ( :h'• ' ,l r'Y I/ •' 1 r fh'/T'� 7 , + �1' 6. +:1! ,«,'t;f.' rL_, .,T•i4 •(( • .,v let ,, \4 •,i lI , }p..+; 'r"T . h, a Mr :,j..•�i+'� {; ,.i':!r .; `;. [ tl it - 'j' 'it �:';• �;, �, [ Clef r'r` ! ;F: 't�� 1 `�� ,n A• � ! 'r�,'1. ,, C4J }, ( i,.•7.• .t, ,'/ {7 ,.,.� :r 7. _,i'.;.,i ,. ? _,j:S "it },! .. �,1,(t.y(`1�i71 t't.,S�,'t •4 �'' j ,,i (>I� '1 }r � r' {, ..,.5 ,•r`T.t� a,..,,,.. :r !f. - ,. _ - `'��• .C' l ,! .� i �1,r1 •! e;1' •F' �Eµ�,•+,,5• -'l6, , . (; :.,;r .., i, i �) i �. t t `! }- It •?rfPlr;Y. ,,; ',(t-� �, .i. a '}'• _ 't '1�, iaM:: !�?� ;, . *.p,r.y •r:fr : '. ',, •., ;� .. F a r ;r r�7 •};V. , 7,•';, 't �iii 7, t+ !j: •l� Ki: 7 � j'.••i.t:J ++y ., .;•! ,er,;. ti, ...,.i...,�.� +, ! r is F, �i .I ,,, ..�pl 41.."11�{ .f',,%: lt ,r -? -�,�t, � rtl -.[a.fvr✓1 <, .. ., rj ��jl .r'.T.�,-. __ {{ [ V, 1 ,. lrl,+ /l._:. it .y:It'.' '�'. ;+' .. `. .. .T.., �'_•,r +: .�,,:tS;(S L�� • �i`;� ... , i it tr�"�K.��x) /(•(r1.; + '. t.?�. „ .) rr (lq(F..,.,{� YiAIj, J. , •. •aid;,, - i /. .1. f t a It. �i ' t!;1• r .., '�� '�jrrgt� .� �� f• .. - _'t. r,r.t rr., ,1'itt�f�i ter'• a ; •� 1. � ;;P �p r-a ,.aly;• .:' �-' 3,1a t �'�- 11• .+ ; ,',) t (•r!, 1,' '1' _ ►r �� S ;.::fir,� a r.• 'S _ ,+f, •i t-.r• 'r:fj; 1 , y,�7. °,'• .'ty ;i�t'a'+ ,�--+, .it � iI - i .1. S! ,.�'.t + .` %y.... �r T"'Jr�,+r .j.�t Jt. .7 , ::' -�-, Iar� ' , •J; -1 ' !' rl t rt i »�F-ra FF l 4. ' ,4� 1 ' •':.j i �:. r .'t��.)t tt '. 1 ) 1 �' ., .r �r' {: 7'� ^9Y r� ��t�\I �,�'� ,: ,J, ( w r�1p)[ � + �' +I! , r�It ,r �, ja.=•`( :t• ,t r. :�`•';f'iL�}.'+��!., • 2`s t Yr)''• 'r• .a t i� { t � ,+ r `.•'�ia. { A - .r e ', � �',r y.r s� iw.'V ,.'��) :>:� ,.- ^' !i t.. .. t.};� �/ t'F � � S -i h':,{Yti.w• ;` 4 •'r}.,` a{.�;y. f.tNr ,� 1)-' :!,' 'I�f• .- -ram- s r, .• ' 'le + - �� ?��' '^1�n. .ti �r✓,+ t:: !( Y:� �,'1 Y .S.t. i` � T ! ;(1�:• .t: �: f'. •N• - !, '.f. Q^t,i: 7.",n r,,' rrq•- r�,�f..,M ' i.Y �!{j /. �� !1., 'I.'7; •r. t`` ;/t,• , ^' . ';�I i •i�, �,/;Cr t ��. t \i r .j kv +r., i ';S :ir�t � +:•a fw 1 - t-�+. , !S �„+ •' h d' .t , "'ii :'at�...C... .r' it tir �', t,f ''J� •! { 1, `d'' _f. < a r -S� , :.r rI � y m )sr.•.r•h 1'.r.r t. ,;,,'„• 5 ,:?;i.• :-.f. , �.'�Il{ �" it .. r. .. ,!� 1 � t r T-�: , _ ♦'t) � `i� t �} t,r + n7. (, /.1 °�i t -;,.!nr ,tt 't{ ( rr. . . � .. - ', •i s. C�s tt 1. �•1 t �e r .r 1 r':rrj� at1} :.r`�u a .:: is-rt�. �.1 ..i f'; �:'Il: •�� '"i.'` '�• ( "t r !.t. 1 "•�+' .- ' �•"�' ) J •:1,J,' :, .t' 4 • • � a . ;l- !�..-11 : ,� "i' .,.. .�.�� {t rt :'7 _ `,• •!�"t t.' ♦ ) '•' r� 1'�. r t +L Y,a I.7 Is .' -p,. r `, '..., .. ..,....�:.:...,,a..:.:1C.il�:xii F` ♦lt 'r 'Y 1u -. IL�Js�I,. �.��,�t C� ''•' :. � �'4 �,.. ..\u.N'a LWw•......+ 1 ....1 t ,,,; ,,, I f r wr.....��,:rw'•+..�.r..�.......•........��.�,.. 'I .�,•�l�.w.�r�.�w ..wL+ruwrsr.i.Lt1 Y � �. y t Y k � ' ' rt Y*� r ��' ;`jr`�� `it�t� �X� r • � { •�.,: 't..V � �t 1� .�'4 t h+ 'i5{i �� 1 1,t'�S.+ .kc �,tt t. .,• t ''�', 1 �t,T t?" ,�,r,4kir a`. 3 '*�,�Y f r3; si,'--• . _' 1,,��t'tl(t ,`,y��' LAW Orr•ICC9 4 • 1 ` 1 `i'' i`Yi}`, s , '{1� � �.t��\ OF l (it{�1 \ ++,.yry,,r .•t� ♦ f ,.i � J Itt :ti �� C. WILLiAM CARLSON. JR., INC. � 1111 i'tti,t�°Y,14 y `` � , '1 ♦ �'� ��P1 ♦ rMpr[tL��Ow At COw wOA M16N t y LLall,}•r Yp� {,t' 2130 "Atti 97RCC1 AREA. COOL 714 SUITE 140 TGLCPt40NC �DO•i�ll +' rt HUNTiNMON BEACH, CALIFORNIA �2&1817 t{S`i4''.,�,y-fl August 17, 198Q r4•ia, t,�t� �� y +� 'ti t P" � �,•iti i}i? d!�, L\t`�.'l• Mr. . Arthur De La Loza 1 Assistant City Attorney City of Huntington Beach '��«•�I' 20UJ Main Street, P.O. Box 2740 Huntington Beach, Chlifornia 92648 ; �.# Re: Sale of Real Property Estate of Sylvia Shanarick, Seller Redevelopment Arrency of the City ';y i Kjitr T L t Nilt . of Hunt.ington. Beach, Buyer i fit rt' Dear Mr. De La Loza: r� , Pursuant to your request, I am enl ` )sing herewith a certified �r}�° b� copy of the Letters Testamentary o* James A. Shandr3.ek it the estate of Sylvia Shandrick. � S r 1 � I � �r 1 !: t: ' y0 S ,tt �4.1a1 L{ t�ti 1 �!1 `• t art � •,, 1 �."�' t � t'�tvr ii 51.'7! t'<:tr tl t 'f / '• 1.7F�i��1 i.4r. +;t 'trt�j.,�, t . , ti t. VIIILIAM CARLSdN, JR. ,r;► tr ` t :l „1 Enclosure , i z cc: Mr. James Shandrick At � � r�i•,`zr` r,,r� r:,t�(r x lt� F�s��v•,r rC�t,��♦ '• a ,��' �+ ft T b t�• y ,,` r r�t r�,tt y, 1 tl ,�1fr�rtl+, � �r'rT/ F',^..,^gin Lr. •} r� ,i5, wu... ��,F�.p�- ` . �Y,.' ? 't •.��+'.... wt AFi t S rt... r t ,t,.•t�y �.�, •,�' { t `( t ? { P 1 ., t 1 4.1\i ,.1 + r •f(ti ! ,'. 1 � �r ! r t}" %- J <1 I 4 r f_, � �r t ry ! i. J •,, J� 1< . r r' , .J':"• '1 t.,�s •f: r )iti '.t.'y)it'f,�.f F.t r�1!. trlr j' { irVt t:� J,r r{'/ V,'. ' + �';` >` �,.Cr�, ii ,•v o� '� } to .'i tsC;�•,i`' ^�t+ q.il t'1 ',I t •l t � ''� s ,J1. s,� ( s s 1 L .•,r r - y'ii i/J•1� *�� y t• ' t�l. 1 lam'} ��tt.,wrt•+rItlrrr�R'+�r7 L .y}f i �', 1 :.`.r }i rir !It ;l.r t ,( 1.�� ,� 1 s. r 3.j` r ''' �t� 1+,1 � t. 1t.. .J t 't i 1' ' �.. , I,J,T, + sit,. t v V1.1 r.,. `:'', ��.. t s .t • 1 . ':;;'r r-,� �j,' lw '�r' ' 1 Y „Fiji. '.t "' y �'ijr ]I �' 1 T:S'. ��l t-1 °= ` r.^i, IS ' r, ( - rr'. -1,. ,.. Il .,' ,:7•��,� ,�r,,•t • { r �.`� r� ��,* +"� i� '�t�3) .,+t�: i .� -I l _ :i jf ,• t !.b ` r,! ll' � , i!`i r..SJ ','/ i(1t•..� a r; +' � �>;.f.tV t{:lf},�.,( �:f� .l1( - r� ;; .; »r` .,., 1 •rs t r .ii t 1•if-. �ii •�t� "�l )tl�j-i.'t�- A•;[I''' �'`r �1` - Y,41�'� ,ti C Jr •.�.}F.t)'( ;i 7;ys.i i',t`. V '� t;: t y1y -i 1 � �, .f � * .'., •) tt, `.,s .7. i;7AJt s -t..,� d:r.� i.+ ',/5�. r • •� ° '_� r �`}i i• '� ,:r � 1�°, ♦{.r C t r s � + Y.��;fY °`� •.t: •{.. j.r � ��%j7 ,a r / S-j U ( '/'7• 1 i > �1 ' j7 `I Y l � +' rr 4 ' !�� y� i � „- .� 1',S i I in'� V t .7t� } +' • i t� � 3{ t• �'. ' :: ... .�, ' ��++t' �:a?t, t t r>= . � `,,�A,'+{f)' .• J.< J l ,1 J 1r ,) `' 1 1 S '~ 7 1. tl � t, -ill •e�.rl r- f .r� •y .,r�.�- �' Jt ,,'i:(� ✓ :> t V�-S', t21�Itw�,�r� ,t ( -� �'.a Sf �'{i� ,:IIr '�.'�i�a7.V. �?1:1;•stt / '�� i-tY" '.t r`{.r4J Z75'�.•it s(t.fS,.i'. ,t T':1 1 ' •3 -i{ � 1 �, ,t F �.' •'tr I i r rl;l:f�l 7'+., t+{ n Cir�i4M ttt; .?;`� tr�.�{jj77 �• (� + iF ,f r 1' it " !s /i ;1 !,[+ .til :t �� , 1r(. t V;.( l,y f�4+ C ,�P:r*}tt:{'�. t, M"•rsS1•� +t F`Y t' 1 t _ +rt. J'r• s!t ^'("!, � �l�r t,�� 1 ,, (r+ts �rlt ,r rifJl, 'j�l��ti,s r_N .h!�fj✓�`'' ' t�►"��`f.�fr': !}IC. •=`fi��.S��eC{}t ..4` t ,t t. t Fj'l)i 1-t. '.'fry-t s " `••�- )..`7 i !'It y�,'r:/A�� fr7.--C'L.: •'� ..rr1{r i( lii ,frl t tv 5 M ( ti ,�/t t 1� i.rC•I , i. it',, . . „•_t [` i.L'tr` �'k r.1r 4r lF I. '�tK , >r 7 fr S..i t7 i1''t ,'lA }t •i a•l r1?�, 7 t r !r. �,f S'3y r j ! :J s i I> it 1 `,� •. t : J..t 1,{I `TF r 1 'r..c•�, :p tij' t 1 r" it J?C1 "{y' I •r i1 '1 1 M1t•� i.t'W Sh Fw, 1.1 r1+ I '.r�ttJti'7'r ,}! �'r•S r � r �; r{ ) is r r) tr Sa „ + �{ 1 �:�P r� ,,+}� s ,il'�t�rjl k.j 111 '! , 'jt 11Ky.R�� t jr rr (q �•1 -(�t��i + 1 :r }.r ldi'{�Y r .1 ` l,t , �1�4 ';�'C(�' l/`Lt 1{+� i�SN i..�l� r�l�J7� r' r41 1 ( !� •',.S.v df 1F� Ir .r -+) Ihy ,(,,'' � a 1 Rt'>C��•C i:P ��f�� ,.Y' to t..t?r '...1.tr '� .'. S r • VstfJ ,.otl�. �h tt :.I�=� ,i 1t1 , �?t 1'•1��t�x 1 is ~ .� F• ,�. i. •1, , } ATTO►UIEY eN PARTY N1rr1ElUT ei"01114c1f IA'smr rant A._IL.rrl: 7111EPr101,E 110: /oR couar List IWIY C. W1"LLIAI.1 CARLSON, JR. INC. (714) 960-2411 , A Profeasional. Corporation 2130 Main Street, Suite 140 j HuntinOton Beach, CA 9264E3 - , r, 7, ; A7TeN+EY FOR rNsinrr;JAMES h CA IDRUI SIIANDRICK ATTOMEY A r 029140 SUPEPIOR COURT Of CALU'ORN04 COUlf"OF ORANGE r #' s1rEE1 Ao0nE5:' 700 Clvlc Cantor Drlvu West MA4rrIaAOONEss: post OffiU0 Hex 030 tax CITY AND ZW r,00E Santa Ana, CA 92701 i p4AKH 11AML ..—. — 1. �1• •J:�JI.'.. ! t n Y•`l r t ESTATE OF INAM.E1: SYLVIA SIiANDRIC:t �,s;�; ✓fI r I DECEDENT LETTERS CASE 11UMUP. �'Sra ,+a '� ',,t {`-• '�i Y TESTAM!NTARy [� OF Abtrlll,ISTiiATION "' i OF AChtINIST11VION WITH WILL ANNEXED � SPECIAL ADMINISTRATOOt) A--143789 { _ tl LETTERS AFFIRMATION � if ,r :"7 ► 1. Thn lest will of the decedent named ubovo Navin I 1. PUBLIC ADMINISTRATOR: No oirirmotion required F1 ;rr'A 0 ( •'� been rowel, the court a olnts (name): (Proix Codas, 3 1140(b))r p PI% +` JAMES ANDRL11 SNANDRICK i 2.CE INDIVIDUAL, I solemnly affirm that I will perform the a i ; rr n ,fir i� Exac•�tor dut(os c!personal representotiva at:cord'na to taw, t 1} . : h LD Administrator with will annexed 2. The court appaintc(name). 3. INSTITUTIONAL FIDUCIARY (name): } ' -. �li•�.t•. ,f , i I solemnly affirm that the institution will perform tiro i emn d ! r � ♦ ♦fit �y • r r o. Administrator of the decedent's estate duties of personal representative according to law. , ;;,�{ lit,, ?r. :+. a t ot h Specirl administratcr of deGedent's estate IrT;ake this offitmation for myself as-n Individual and • 7 (0 [] with the specials powers specified on behalf of thn Instlta+)on as an oiR:err In the Order for Pmbata INorne and title); Q S r �i{w�yyR{{Y• ♦ J ►• •a' ,. , f il. ,'�'R 1'r�' 1 r (2) with th4 powers of a General administrator IM1�r'r 1 zsi I5f The personal rapras3ntative Is authorized to admin. istor Ilia estate under the Indepondont Administra- 't _ 11 ';r • }, tion of Estates Act ®with lull suth-i ty 4. Executed on (data): July 1988 with limited authority inn authority, without at(olace): Irvine , California court sl.porvIL pia to (1)sell or exchange root proper- ty or (2)Grant an option to purchm!so real property or r r1,j' '"r , i♦ 1 r r 1: (3)borrow+money with the loan secured by an t f. t encumbrance upon roll proportti•}. L?Jl(.!1"�.tr✓ dF/�/,�i'�r r rQ Ja S�es Andrew ammo r1ick r. l WITNESS clad.at the court,with seal of the court affixed. CERTLFICA7ICN f 511 �; 2• JULe((� I certify that this document Is a correct copy of the original-)n ,}1 , "' ;, •,�r"; , Data: U Z 6 t9O Clary LGrawilta,CvnityCkrk file in my office end the letters Issued the penErrnalrepresentative fY; 1 •f''�'� CHARLOTTE NOt�XE-R appointed obcva hsvn not bsen revoked, annulled,o;not aside, ,�.•+�' i i �.i " ' Cie&,by _ . Deputy and are still in full force and affect. 1 �y ,� rr JUL 2 B BOB �t s (SEAL) (SEn!. C_*y, � , ) CHARLME HOOKER •i i7f t .1( 2. r}�1;•i rr jr s;r�1 r I' , pp Form Approved by ft Probate smelt 15 4a7.465.501.50J.eta y, f rq•.; i t1 W 1,dcia Candor Callamia (LETTERS Cody of Ci~i pome vt s 2015 e r' ,l'1 'fii i / �-" -�jr:a-r,± r . � 'S.�f.C—Zlrt? T,►-•'^---. ^mew.nM+rr•f.Xt7►.,.. >.va•.n:�r�ztrA.:R:•'}rrRej':d^iq< rnv.rr{naflC3.k:a4+c� 40 rs rtilr.�i; *P��d h}'� .j'- i. A. i�a� ,' r f '' ,..`•' ,, t: „ a r' ' AT"'Cr r,r ' ,. r�� j« 1 ��r- �t. .1,� r• �3}• ';. e ' i,, r . , .. �,.. •,• I,rr))•4, r t `' 1 1 ,.tr p, •p�6y �:tif �.%'R'?I!; - / a•. -,i�+" l .1," 1. 'c. 1' ;, •,-? '1� f' . , r,�•�\t r,, .f`R•` 1, }L ':.'. r , r � .t- ,t ,i.`.Ni �1.' .• r ri, - I �tr t �i' �/ p�'1 71 �.:, ��r M..r •y, tt _ r. ;. ,i �.,i. '.,I�.,, •. , '.f , i, .��i � .t� I Ci�+.• r,.�i 'r:r. i�,! '� '�U..i.{ �f �i 7 r'��tx.., ..Z... ..' , '�,.;•..': .a: _ ' - , r. - •i„ ',,,r U--• _,.I,' rj,.+ ,�, r�';ty- a�?fkr o r , ! 1 r • r ��,iJ^^A�t _:� ` ,r � f _,i r 1'1 , ? s:,f n .I•��;•� r�) „ f - , : ' 1_I• , CITV OF HUNTINGTON BEACH INTER-DEPARTMENT COMMUNICATION NUNTIN6T001 11AM ' i f O To DOUG LA BELLE prom ART DE LA LOZA Deputy City Auminist_'ator Deputy City AttoLney ` Subject SHANDRICK ACQUISITIo:1 Date .August 25 , 1988 f AMENDED AGREEMENT t One of the sellers in tae above contract has died. After the above agreement was Approved as to Form, William �► � ;;; Carlson, the attorney fcr the cstt,re of such decedent, � Z. i notified us that the two surviving sellers were "DISCLAIMING" any interest ip the realty. He also advised t us that James A. Shanarick was empowered to sigh the agreement on behalf of the estate pursuant to LETTERS % , ` . y ,{ �"•'� �► TESTAMENTARY issued by the Court . The agreement was amended accordingly, based upon the S ; above, and because the estate was unable to approve any � ,t�,-• :xr ° •Y�� n7 •' "LINGERING, WARRANTIES" , Attached are the following documents reflecting the above fa�:ts: t ` Q '• r , 1 . August 11, 1988 ',etter from Mr . Carlson, s • ,ti r DISCLAIMERS by James A. and Sharon C. Shandrick, and 3 . Letters Testamentary. I � { Accordingly, please secure the City Council 's approval of {t the attached agreement as amended since it results in an �f "as is" sale and the tax exception numbers 1 and 2 are now {.,. to b7 cepted by the Age,;cy. `„`•. ART DE LA LOZA /gmp Attachment cc Gail Hutton AUGZ6oft William Amsbary sea '` ,T. ;. , 1 'gMeNrrp r of �toptir�►ir, ' ; 1i,'{tT it , . '' i ✓ 'ct 1 rl yi., .y1 r 1"� +TK✓.K4;;t S 'Y't. '7t"t.. .1l t.? ' F S1 " r/fRlXlNltAirt"-'.cut'`^w..ram.�c.Yw.+.�w.cr....r..-.�..-+.+�...-..r...—..�... ...�.....� , �... .. •s..r wr: .a...rsr::s,�-r:'.rf 1Ws:�C,�, t. ^'T, I;r �4' , r +Y' I CIF '/ +k ' —.'ry 1 , r .il.• I r 1.�., `r{L Il 1 '` Y + l •'..'l rye! 4t\ . �'�J•J 't:.. , •i. ,. ' t. ^J �: 7 )4.1 S • . r ,r �1�� r r = I. 1� ,, ' � 11• r Ili l l ^ �f {��} r;+ti ,� /�►Iv� ; �►i� ;�' Imo) S s r,.,..� �} ,l .'s r r'S`�L" � a yr' ,a, f '•"' ;rr ,•. L, rF , r, !r iY '.; iµ�r i�♦( ''�,�{}b 3 � �I t if ] } � T J� "�i� • ,; "+•�T• t rl s r _: �1 ►"�:�r tl r'4 Jj,\,r M� ,Y ti i� . J •, . y � r� y 'v':I , j ';•' _, ,F i'. 1: t' .f r ! cr }�i' � � 3-�'a'r ;.rt 'Ir i •, i jr: ��,��{ ' ;i• �, +� > �r � � ,Z�� i 7 j, r• 'i'�S� i .` 'p ,�, 11 a ..i �14..r .� 11 '' r fa `►f;t t =� •,, r] ; p •r 1 r= t , _Fr •1,�� ,.i t'F• t �� ,�,� ;t.� 1 ll .a�r rl _1•' la'�ft l * `;,.l,.r `' 1 'r. •s .i! 1 �,`,, A.J. ua `� !'',3 r r5.h t.t`r ( F I� r' r I ' �f • ��l: 1 ,�� *}`l4 ]� r: 7 � �� r r. !,! '1j 1r� r s 't: !r '". .'.6'. :�1� �° •. ,.r. s'7Y�7 +. � r tlp,�, !' I ./ ,, .•1 yrrr.u+i.1Wr+1J..:rY l.,wurr� Ca. i l ! r• sr+ LAW 0/IICCS 'i � �o�h �,• " C Y JR J r I C. WILLIAM C LSON> r, INC. J,ry �tl • IrN 01[Slir011/L CTJM�OII•TI I1N ♦RCA C00C 714 j C wjp ti, esh> ` 'r T. N 60.8411 ,CpMoC 9 -+((, '; i►{i> ,( ri} � �• r, P17. n MAIN flruLct >Z!`t r#t �r]t. %UITL 140 r , 1 \ t A 1 3t.`r �• " r HIJNTINGTON EIEACH, CALIFCILNIA 02040 ', i y �►`'u ,r 1 t p4/* August 11, 1988 1` r J `t�ra f��'2 t •r. Arthur De La Loza Assistant City F ttorney city of Funtington Beach 2000 Main Street, P. 0. Box 2740 Huntington Beach, California 97.648 Re: Sale of Real property Estate of Sylvia Shandrick, Seller It /<, 'r f the City of Redevelopment Agency o Huntington Beach, Brayer ++r ' • � i Dear Mr. ')a Lei Loza: �.,• �,�� aT" a I am enclosing herewith the Agreement for the sale oft e Shandrick Property in Huntington Beach, which has been mad�.ried, i ►? ,,;; Y r? Shandrick, as Executor of err > J"J�t*jrr' and as so modified, executed by Mr. the W1.3.1 of Sylvia Shandrick, Deceased. t ;. 5 lvia Shandrick died in Julie of this year. Her es.:ate is � + presently in probate in the Orange County Superior ecutor of t Court. Fir. -° James Shandrick, her son, is Lhe duly rppointed Ex ;� + t +g { ' ,_ �� fl`, Will in the administration of her estate. Although it i3 e•ar usual practice to require a c:o�trt conf:�mation under the Probate Code of any sale of estate prc)erty, M�:. Shandrick and I have discussed the alter sate pruce6ure for ma)cing this sale under the independent Admin3 .tration of Estates Act. since the grant of Alt, . oi. .tment as Executor by the court gives him the r rr4, Letter:s and app power to administer the eLtate under the Independent Administration of Estates Act, it is possible, we believe , to sale without it being subject to court confirmation. r '' „L IJ ,r4t s; ' ►� make this This would result in the salon not being subject to an overb{d r, ; 5elieve this would be advantageous to the City and rocedure. I ,'. x P also to my client in consummating this transari ion in a much shorter period of time than woult3 be required by a court :1 f y` hr r + •' irmation hearing. The changes in the agreement reflect that the Seller is the James A. Shandrick, as Executor. " Estate of Sylvia Shandrick, by We have deleted the reference to Mr. Shandrick and his wife, ' Sharon, in their individual capacity Elam the daaignation of !q r IiY < s sel.ler_ t 1 ytA� r;1 i `iWi, { A 7u�1�� yr i �j, i r Y r It { {3'� I c;� r /.• �,� C I L ' A i'r art is yiiaif�.`r �r�`. ,L. L�y ` ,.r] rr t'..• ' r j" ! •� ..I rs l " �. �1't�,,'jf] St�(t r�y¢(�ii�sy ry1 lr " ,dff `i C..]r t '•�' °'1 ,: rf f t, r>1�M+r ,!, ' 1� `t.�.:y r�r � t Tifi . . iT , It> e- `i'r�'iiil + 'j ?, r ♦• �',`+ �fx'"`�j+s` 1,.r ,,;i a�';;fp�{r-: :,' r ♦!if]tN�t ll T��✓�� ( r 11. fL Is. :� i`'� dr Ycr��r'.�.-r;.,l r' r11.V.°>��?ti/ 1'r4Fr� � r .f t,t { ear. rtlr I •� jl '' l�l� ". i ,. •{ ! ' `r r �> r {1 ';`Y •!1 '`'] , ;..ill/S 4Slyt�Y.t iY�• ! '2 s s, � ) ti} r r -.:r 'ti ti •t r a y � y '] � '� t r,Tt � y r, '.T r s.t{' r• r � ]' j�� li) t �J r �• t"r.}s kY(�t r, rt'�t �W.��Y�.J�t� � i Y lrt` r� 1 r , .. ti r , tit , r •^ :: s]7 1',�i fjj`T� 't 1 r} t.e ylr� Yr -,: r t r3 r/, t "tiI S � r , r �� 1 t I c,: ;F ►fit �}• t � '�tt'1Sr a rr� ,i .,•Y v.��r�T fir...'' ti lf..r -•••] �� JI ` A. rr ��,YI lY.' > f i > ]. r 4 r ' �;fi��5 i��r�,st��.•��r��,�i 1 �. ' : � y�y r ��"��I+,! t">� ' i Rt' r, s r!7 ^�l+,>: it " l'1 ] s) � .t. , �� l �:_ r �r i,(, ij� ♦1 IT< �}'. 9J7 • f 17r�1"7 •^ I1 r - r� (`F" lei: ' �' ♦' k�' {.] �+-� pfL t L,-r 1a i t•�r�(fr r� I � + ' rT r �F 'r� � r f♦ i...s r �Y iSy ri ti:„1��,t r`s1i� Y •/, ' �<: ✓,� •' ' t` l , �i�r f � ,-- s r+ r''.,i.Y �:rF' i�>Y � ��1 I, � i., ,I Ir � � ,111 .,�.�• r.x, r.! .' r s Ir'.- 1 r •�'' r�.r• �'4.. ��r �f! �r.. t S t, TF 1?:�, i,S �:!',. ,',•' �'�i'Sa�.,t= .' t i. ..its 1 r i' t3 „ :�,11 .{• Lr� .', , a ,% t J: �> Ltt I .a"r . "-1:;. t sJ.• 1 L' v� t l 1? .tY ,rr - � „ z . �Ale* 1.�+,•J iii "•r 1 :.fi �d fir tI, •r t, 1' , flu 14 'fit J �l. - ,' r , F -'L }• - e. 4 !� 7ytl' JJ" k• L Trt '��l/ A`«�Y�+�`r�1'l^ / 1 ;. i ;'' fit' S ,Yj�� 11 _ • t 1 _ /� -1 ' .. f .•{I!�'� r k :, N, f : (tIA i�t ! 'f •�� : - '�ff - r f - ' .��, h��1:(;�' t � ij�K'-.If �, i r ,�. y.� �� l >•yy,,e1 , ►'J:s.D:_''1' .y :�l,.iz 1.r�Xa:aa.:u.r_7[t,. .►..it rriu..:-.—. ,i �, t 4 1i I L r f L If �Y' ••.;sry gat ,, ��r a tr u �.�,:�' ,•.. fit, 1 +• cif , �n y x t�/, ,t i : ) 'yam ` a Arthur De La I.oxa Assistant City Attorney City of Huntington Beach -:'- August: 11 , 1988 ' r' A`rYJr Cf Al The following other changes have also been made: ' fr� ; The First of there is on page 5, dealing with the exceptions on ,.�s,l �. t►" 3 j "''. .` t1le title policy . ]. believe that the exceptions should include yr�i. ,. Items 1 and 2 of the tittle policy which deal with the matter of 'r certain of the real property tares , alien not yet dAlinquent. u e ou an concern, since there is a This should not ca s y Y fn:L "fir „` rovision for the proration of taxes and a charge back to the �'' p !• t;c� rFr1,; Seller for the period from :Ittll► 1 , 198E to the close of escrow. Also, it is my understanding that once the City is in title, there are no assessed :axes. ' ' ''} at With respect to the first complete sentence on page 6, I have 4t�,y ..��; modified that to merely clarify what I believe is the intent of ' .'° 'that provision. I presume that that sentence refers only to future acts, so I therefore added the provision to clearly make L r g r it a prospective covenant from the date of the a regiment. L 4 l Pages 7 and 8 i.,iclude provisions which could cause Mr. Shandrick My client to violr.te hib iduciary responsibility as Executl�r. has no knowledge of any hazardous materials having been deposited on the property being sold. However, for him as Executor, being she Seller in this transaction, to warrant and n l?, _ to further indemnifythe Buyerf any damages as a result of5s •'` '` from { t•J�Su,��y S,r,'` f ality such problem would cause a lingering warranty to attach to the Estate. I am sure that the court, in a sale subject to rr „r T v ti r a court confirmation would not authorize the Executor to make r I 1 F r lil r r '' e r , 7. r• ��• �,S n It ,' ' ' ', ; such warranties. Advising my client, as Executor, proceeding - '• rx ""+t�fi + s} I without court confirmation to act less prudently than the court a }„v �° ! I cannot do that. Upon r7." t would require, would be inappropriate. f ti5 �'(lt4 i'kt; / t l:• L°} l �,�,r`�L, �, f•,' close of this estate, the estate's liabilities must be fully ,•� determined and resolved t4ithout potential future liabilities. In this connection, please note, I have not deleted the warranty r that he has no knowledge of any such disposal on the site. •;.,r ,w � �j" r' �` '' However, this indemnity, I believe, goes much farther than that +Iftt 41 yl; fy and would even apply to those areas where .�e have no knowledge. t °t�F • ,�t'; rs�r Irl ti i,`• 'a This would be inappropriate In a l;wobate proceeding.. L• a TIf7r`;L a[rt 4 r y iY yi' 7 as 1" 1 i r t L , trr f F d7 t-AyA 7 1 L '.,�t t.• t.l. •, �� '.•. r :.1�1 t :�. •t.• ._,# L,.i''� TI .v < Jf�_t•t1 s t l! ' 1.. , t� `.� l •I' •�1� �, r/af. , � �l�l $• -..� ' ., r +r.�! t 1�I`,:.�r 1 - •�' 1 P ft�I X}�J ,, �ti11, 1 1 '1.. , r,•. d ,, r., r1 . .,rt } '1 'fr r fr �/�+ri ?I y,�F• +`. ,R , '��f S,r•;.a t`}}'t4' :-, ' +r, _:� { :F.�, .!.i ' �. ti .*L i 41.• ''r' �� ?!�' ^'!P l� rl�, •r t ' ,f�,t,l .�:`. x '••;_' ' ' L'f I �,> ir.r+J'=rtt. ,..'llt� 1 r'' f -jty'�+�� '1"�4t�t•:�a, e�i{:,<~ ry�*t��' �Iti (-}� , ` •�.'. ri..,-, �t ..fat ' ' r t' 1 ' .lf .r.��: 1y1.�;tia� ` ��,,., r r� r � y,'"I`,,'�i f ref SI t,i Jtl.[1�1•.r, 1 ��•' �,' T �''.il 1 r .' ! Nt} F,',��J� l y, l7•,Jr . r';1 Yt v k1r+i ' 7 '+� ty� rf ftt�} `f 'i T �•yy'•i� 1),: it r , L+}"� ! �� t i }i} r, , , :IJ a i; •' y � ty '.}'+ roar r r•.•, t7` 1 �} � a; J �� 1 fL � 1•:+ 4,�1 f ,�Jrt LJ4r( tr ,,;t' ' y��'�njL•,'-��+ �i: �j :f,r r [ j , r t Jrt 'ter r t� ''i iS ,i1 i, , n�'•�a �r� .�, !r }.� �5 + ` '„! Ly�t .' t -i' '.•1 L ! ti. ,L .�` ij.. y I r J `'{• twt. 1 wM r• , ' l TA•, 7.•;i \ �t• ,! , Jl , • Y•. "�,` , 5 r , r r trX��Lir"�'�;11 r � �..Y'Y,�.I y�I�N .,•'.1 >> � + '`1_' 1, ' .. +r - r �rl �!'t P !« >>t � � .t. `�� t irf"X>titY L,��.�a,,'. ',,>r •.. •S (•, Il' :-tl.T l.'_� � �� 6� ," - t _< T 1 t, L of 1 �, � 1{• t ,1��.,i.� �1", '.,,•,;� ,. .f. ,1� f ,. •1. t �.ti I .S' ' t ' 'ri i _.r1Y..1 �'1 •'T,' .�1 .:::.. �rli.�• •1 .� 'L.. 7 : ...., 1� [, V1.., ,i� r5• S'- ,r :L1 iT� :��. .'f LY •�, �,�� , � '.1. i' , '� taw, ( '' _ +; fj, '} J� �'�•' Ffy '�' �jyf, I;�h,y +F'•r rM, 1 I '+ r ',rj is ,' F i + ., >. yR"ri J�.� 1 ` � 1 1 f• ;'� '.. r`� ' 'rl� `fy' Sri;1'Ft��' , Rwtr Ckl��ry117 y'i r � ' t.rs !+ 1. Tr I rs. •1 �1 kr t� 1 1 •� I ,.� IF • + �; Lt ,1� r:• r s: +• r "�� ,' a,,. rl- :�5. v r..E.� J ,,�� 1 ��1!" r r' .: 'f ' � j rj R��rty:'s trf ( c F v; � r r. i } i t r'• r f r i,�flh ��1 + :5 F rrr Y � r4 tT a �� 1 t t rT � r) 1Q r Hr*_ �~ ,,' / S f 1 r- :•! {t r } + S J'�l} �pM r 4�1 ' J k 5 r^�` ,) ( � _ r rl�r- �•}L,,.d.,,,,tl JI�W 7 1 r, .ie� Nt 1 ry��o-,l FI �. 1 n J I+�.�e��. I,r xi• t .i Y s, u, r, Arthur De La Loza } . + � Assistant City Attorney R City of Huntington Beach -3-- August 11, 1980 J �+ 5 �°fir!•��J. � �� Please contact me if there are any problems on the above. If satisfactory, please return an exec�ited copy of the agreement ' to this oftico. I appreciates your cooperation. Very truly you � J FdL �r(( 1W1 •:. q VI.{� C. WILLIAM CAI2LSON, JR. y r 'Si1 i� r ) •' Enclosures cc;: Mr . James A. Shandrick { Mr. James M. Shinn t rr '(' +I' kM•�•.r rat+l K 1 n .S f 2r YF f,r,. •' Ytr�N 1.``�Y?Irs F del t t' t r. 9 � fr i' r�r rs,} s i��ti� (rr,r �yJ •.! •J , rJr�(�� .r� rr1� �� r�•!s+.it r ' � `{r r�l+y y(!�J,• �il• ..:'yr` �f^.lk•� r'�.i� sY� YIr: j ''74'1' ).� r.1J I, , � ��•�r�11 !r 1�1 ,ti ,j*�� (f'(y[j• S`Z� �S �'}a ��. 1'^,�l• rrr �r; ( ,�'�• '• .r I -['' +''.1' r,.�r 1 rt�e. .'1 YY S P r��Y(� t"h. +. 2 t=r ;ep'• ;T:.�' J�,r� J.. Fz�yIT3. x •�'' :'.' .w � ! 1 7l 1 f)^+! rt 1° ..:rJ TPr� ti ;!1 Jf f � 7' �Y • �( (yty, t •T-j+(Y.:�.. ,� J( f r ri.l s" :_ r :•f1 „ �I y a /#.`� 1 ti� l r y� ri C.• �' 1 I t�: i `r•"^ , ~ i+V�r +5 �� L,,,, rrr •..^� `ss��-5 ; r .�i 'i t�.,�`-rt�.. '`�1 ir1' j�� 5 ��r�r�,Y.�S. �(�I ,. � t) f', (t�� .y�'I��fl �sl�, rt � _r►v rf , J l � }� ,L`1{flv rt• Y r t `•-,rJ r t' !Il +,�' ,W 1. .1 i ;�' tt: S i ! rr„y' a i; ty,f jn{.., rif + a .,`;s.2V �k�•f a 11[�{vi•�'t�� "�� y ;+8l(•�r1` �� rlrr, ( ,Ir� 'Y( .�;t�! •-' �4 �ll�� 5 r 1(,1��J 1.^Y•.�N+ �•,'�{�"51 J rl. 11`!• r5''J{�fi ,+.�'+.t>�,w �.t7 `.'� .y7 '�rr � )5��1 ,,.j,1 tr' �r ( (��; is T5 3 _ ' ,' r.•fr r i I +jC` f 9y�4y � { ,r f + F r it s • rJ ^^f}, 'r/,r `` s i •,',J+ ( :ry >• r � A�S. ,2 ! } �t�,I Y's r A lY», t rJ LA ,+rr trr �'f r •,f}� .�i l( r 1.5 !, I �r.�'! �� r' .iT}Z'j( �k;� � ,: f .� > ;+ } •� Lt r r 1' r , i +� 1 >, ! �.S•t rYYnv� + +jf A !IJ � 1 ,+Tly �', +f r Y2 =�. Y � t i , i t•I ' �I•, 1 S,� t�tR�+'/+ ��T+ ` ~J( 1 f rsYi e 5, y� r 'Ira r1 ,_2 _ j`+ r., +i jr,A -11! 1 •(t 4f ! � � I '`,. 1 •t"_. '/1,4+ t�}� /�.,r� � S?F ,j�r' ' . ,v . ,.,• .�. '�',�i ,f�' '',. ..;itx t /: yf 'fd�71 r Wd�j ...j -� t: YS 5 I '�. •�� .,F:•s L ir�?5 9 �:#t rr !,'i 1rt (� r)'..;d , r 1 "� �' r5'Y,;111� '.'.» T -,1.: 'rt•• ft- r R' 1 s',, r. 7. -r.- ':r- _ s ! y.r. • AIM r-r , _k .r F4 �= i i • i { , ♦� �I�w"1 J{ 't i `,7 •t rt. ) •�, . � , �,, •Ir � 1 � I i�'1 �y�t(�r ��. � � apt ! •i�• .t , � .�, °+ly� r , ,. ° :;� f� `c�' . ..�..,5... r.♦ .+ ....,..'..+II.,...a.......—.e.h«.._:' .,:++ ' ,".l i�F�;�:' t t'( f i r'pSYP,. r ,� ' � �` LAY/ O/IYIC C[i d t '1•t "r��t."jr h •`�C, C. WILLIAM CARLSON. JR.. INC. T�„' :. ,t`` • r•r10►I�ti�ONwt. C011/ONAt�ON 1i i `, APEA COOL 706 c ` frr 2tJQ MAI►1 $THCCT v �+a,.• + p�yp' '�'+{,y�rir 4UITC IAO 1CLC HaNr Js�O.2411 f •� 'Y Ff*,',;, ,tV HUNTINGTON OUCH, G\I IFORi�fA 02048 'a ` r ' August 12, 1980 I'A .x+'` �•. I j 4; rat, v f► r�' af1r I tr 41 Arthur De La I,oza Assistant City Attorney City of Huntington peach 1000 Main Street, P . O. pox 2740 Huntington }leach, California 92640 Res Sale of Real Property , L`� l Estatj of Sylvia Shandrick, Seller • " r '�' Redevelopment Agency of the City of huntingtun Aeaahr Buyer Dear Mr. De La Loza: 1 Pursuant to your request, we are enclosing herewith copies of the Disclaimers of James A. Shandrick and Sharon C. Shandrick relative to Lots 25 and 27, Block 204 of huntington Leach. J y tr 1 our t, ti �t t •r ,� i !� i`y4 WILLTAM CARLSON, JR. �,�'�•�; CWC:mr 't '�.�r •,„' EnclosuresX. r' 'X 6 S6'�b �1��♦ {i.• jib ��„^ t14. v., i1 r: ji r ! ,! ✓ �, it _t i t _ } ,, S CF. ;'st �} if tr � ! r., �t�,tii>< ti 1.: -1t .•. . +,. .gyp if , r t 7, t.t �,; a, •f I Yt c �..t ° #rit. } s 1 '�� •.: 11 ,+{3 ~ !'� *' r ,�,� \, ` �• t} ` ' •.'i i � t-' lf1.-• t 1 rl�.t,� ,4l:lr r T{''t r�,;P 177"' ;1 t tt i � 1 ri..r,- r , .{ , t , .•, c { 't yy, � r �1 J' �f y7,t r cirtf� F / +t 1 ,t. T' t •i/7 i %),.,1!•"i,� i r�fr �. • � ��t��rF ' D��+' �1'i9Y}�'�� Iit:�.•�tt ,' 't'.i.' ~r� r 1 �=t .t1 4� t 14.,.f1 �><`'i,�r`p�'_�7.jtj y►� IJ'r�'�fr r,tl r.ij{ti ,rL ., >, r , yl ,�, �r r+�� t c i F.'�l 3}r z�,.� 71' t 1 ei , s'_r� •' r �,., ! �1.::�, t 't t� �f` t 54� 4 f !t�'�+IIr I� t rr 1.ii�r}ir _ % t +i;if{s J i�7f ��.. 1 Y Y t •,i titrS , rJC . {,,f• r?�• j T 1.�r ! � �{ S t •fi�"t f x tJt' Iriat {f ► , �1 }� r,'j } a }+�' li, fir sj� [ �f/ y ILti. 1i''rlJ } f{'1;c.' --y}�`y�q�{}`',,' 5 'T t � 1' i '\ •r ♦ ' i ), r +i' , � r t 1 rt.C_S '.i Y'�1 y I ��li3�ilfl�f•�Li" t ,t Yi�►4j` t tr,�'.r t—� j, r lire d:Yr ! r Ft�t'. ♦ ! �, l rii Ittw�}��1`v�`f .I4 ff{rryVryV GG 1 ! tT .{ �i a i~(•l� t J>t1^..t �J 1 .ram i'{ � ( ' , 7 t�,t +. '� !j � �++. ,7J I i,J ��.,', � gr Jf rj.... r 1 /,. X 7r:tt .•. .�t .; 1', 1�` x�',�,�A,,4'1t ' •�T ! �� t % t '. � A: -`r j 1. ` + 't�. 7( �i�I '!��* r i' � a.Lf f t 1 , 1 '' •f 7 7 ,r! j�Y 1 .� f .f i t 1 , , r t r 7 {r;. �.r f �r ,t,t t)• ..3 , 7y�,J v' yNi :r��aV f. e/�, r fr, -, A ' r't 7 �1 •,I �. I��r !, 4� t � r�ax" r �� ' •/ r t ? . y ,- 1 ,{ 1 1J:,, ♦ r i 1�!t .its ` 1 , '•••'7.. 7t- t}� t .l 1 ri ',. �� ,. r4 t r,l :r ' "�� f ` '�.` i,. �' r �� ' (, .1. .Y '�1+ b �t��l,•di 'AlI t5��• x41�r �rt l �y t r�� '�.[ t ' '; e 1 j'• , ,..r „ ' `,' 1 1 :t y ,t t f SI t I 1 I, ��' ';o�•�� JAI 1 • .f' 1 � � - F _ , � ''�'.Ire��y, •+r< r_-: , y I ► ,� f f t N 1: k 1 t.1 �' ✓ ' � . :. • - t i ,1-.., rr y p• /.•. ///yyyy��pp��,pp�•••'''''' I, f E. 1 Y• i 1" � ''�b�" F 'Yt � j•� 1 I• .�7F - er rr�. , ,. •' Y '..�+ � �',', •'• �r is .r+ � ? .b _ „J +: ^h4 lsa{`X� •/y'. 5"y{pi,�r,.��Jy�Ai!. 4 ,f, i ' ,�� . r. ��.� a r` �"�' L_� Cy�•:r a: c� r.y •� �-'i f�'..ai .:, r,,;i+ ,,, - ` ( 1. :4 l 'rl, 'j/'.".• ,�,.j :.5. I,�i+ . '��•�' � S!'h - '•�{ 1r•, ,!{ �F ,, r 1 1 ,no 1,,.�f,'31K�[ �,"-�'r,• r.ii � %y'r�•,'"iV�• d 4Y 17 .y 7�"r t�'i. w' a •. � h+ �,k. !;1,",'i''ll;..l!'ii'r ,� ...�. ...H ;� . :., r iF�'..: .��?.�f.....,.:i.. . .. -4 ? r{�,4..y 4,1 ,.. o- ... I • i.� L....w..z•�.......w'a`.ar.,...t:.r..l�;`wL1-..,l..r�dw..�..ral;:::XC.ZXr,=:rM'::.,..�.r.a�t wt .,I4<....:.s,.1 a,r.i-l+r-......dd..a-.w-- ,[� y� .r t s t t � •.F"'t" �i + ::, 1 1 �Ir•Y6 h+..�rf� tt `'; 1r `.,. �. a . , ♦ y . ,� '... r,.. 1�r { ry f 7 'r'fW*;,I dr .r� �.. � tlt,�: t'^ ti�.P`t �) `� ' It •)'? 6'� 4 F n�4•.` { '• /ry.u. �.r `r ••. 1 / ' l'�" � /� tr � - r� ,'1i•i��,F 7� _; � , �,,I� - r r:� - � 1 l'.�� •v t• ' 'u►r��pit�lccio c � ,�,:� ,�i 9 '_ , I°'' �f �+{(� I'A4A1\ tARL.snN. in., iNc. �� 1{...C, tv r 2 t•R�fR/t10 NA6 r411rti R11110N �' -ti u rl� 1' r 2130 MAIN "RUT npy r ��,,\\\(•T�� OJtTC 140 11 it.st L {�Yas/ 't '+•S�L r'�✓%. 1 ''i5 1 S It17/1TINOTDit OCAc11, CALIFORNIA 9204R 4714) 900.2411 , f r s+rr'�•; i' t 4 1JUN 21 1986 JAMES ANDREW SHANDRICK Attorney for GARY L. Gfir�hVlLIE,Crlunly Cleric . , [„�'t•,� Ott`,�• j•',.i-� '� , } r DY . _DEPUTY r y }X 1 � lr t�rti�.I� '�►�r r " �r�jl �82t�:'� '�' F� !•' { V ZFj.l -. N2 y3 �,yt , 7 ..:�ll I/; i Rtt 7 �r�t"1wr y. r• }' r,.�`. ` SUPERIOR COURT OF THE STATE OF CALIFORNIA • ►��` .,° .� 5r+t" �- FOR THE COUNTY OF ORANGE r � �1�•• `JQ4 I rt}a, to 1 : j4, 1 to tt � XX- Estate of ) n Q I. CASE NOf' rr,h1.t1 1.12 SYLVIA SHANDRICA, DISCLAIMER . �' � ]` �• ,c; err t � t, 13 Deceased. 14/� 4� . 15 I/ JA24E5 / 9 A. SHANDRICK the undersigned/ declare that. I am + f .yt• /, S • �'bF1Jt9' * i!'. \ :".a `ram 1 e son o 6 the SYLVIA S . SHANDRICK, who died on June 12 , 1988 , in the 17 I City of Fountain Valley, County of Orange, State of California. �u '•y,, , 'tt' �: ,�•� c t � 1l� ,- , 18 Prior to the death of SYT VI i S. SIiF NDRICK, namely, on r: t.,� i ��-� �� , °' ��, ti C err, _. , t•14 ! ,�� 1 19 September 21, 1987, SYLVIA S. SHANDRICK executed and delivered a t t iT4. �tt f rKvttclst, - Jt ' 1 ;��/.�,I,Y�><''S,4 ,t .4 "• L /, .. Q 20 grant deed from herself to SYLVIA S. SHANDRICK, a Widow, and Ir I 1'i\► ��td1r i I + 1 Y•'Itl i'.P ly i'`��.� s'1 t, Yi ,1 �� ' ':� 21 JAMES A. SHANDRICK and SHARON C. SHANDRICK husband ar_d wife as �r# 22 mint tenants, to the following described real property: .� it L�p�� !1c 4.� �t, ' �w't �+� I,k+'a i•Sy ��' 1� 1`. j 1 r fi ` it7• {,tl!? /' -'i ..�`,�,'`Ir S'' :3� � •1`4l,rtr'''L'., ! ':.1 tri 7l'4i 23 Lots 25 and 27, Block 204 of Huntington Beach, 3n the City r� 1 I,R'�� ; ,1� .'r i`" tr `• r� �. � `it, t l: �t�l yS 3a. of Huntington Beach, as shown on a map recorded in Book 3, #� 'A1 �tj�4•'ty c;E r, 24 page(s) 368 of Miscellaneous Maps, in the office of the ,I�f i'F x �r ' ��A`, County Recorder of Orange County. ,? �;f',; , rr;►r r, F t 25 t t t ,t ftt .11 Said property is commonly known and numbered as 200 Main t L I � 26 Street Huntington Beach, California. ,' '�ti �►� �i' �� `'' `t j�` '�,{ tK�s��sJ "y�+�tlt�rY•'• 5 '! � rY s f?Y��4 ,r �±� ,1.�. � 3J•Yti��@Zi , , qr V , ,1, f•� y++ , 17, \w 27 Said deed is dated September 21, 19a7, acid was recorded 1•r ` e,5a r�Jy�','�rr' 11 i �'�.1t, � '�+0, `.1•,y a d Y� �• 5 r�y,t,�F�.,'�f fr:. 28 E °�� ti rr lei. ryftTisl�..,�` ti•/4 �l:;Twv�� L x',�.,r�S�K•r�r.��4 1 A�+1...r�' + :�� +� St. t Ifti '1 `'r rl. 'r - 1� '� , , t rt `i�i �) - �r.tfll.�",�• S� �• ,. •k� S �a , ' ii- L .i. f t, a 1a Y 1 ri' �' r� (tY• 411,I•fr t i , ,I ' , 1 ,71J t i l 1 r ; t•' Y. •i 7rIr i..�r�ry•:,.Sj°:r,' % 1 •7 , � �� t'F'Ir�lf 1.11\ J 1 � t 1'.• r. + It � ; '��'Y ��Ij,,i r �7 i ay�A�j: '1 t' ,'K?!', ..Jr: d ( ..r r �1 �i,• 14 F' ,. .\' ♦ _ , r f Yr' !l r _�];. k i N! ll S SSF,1SSr' rs t r + '77 ,� y r„�ra4jr$ �} �l1}{ ,i r� .� { '�St, '� > l.• tl _] _ r. 4•;:1 •,r `!'i .;,Yr � � r r A 1 t!3 �-,1 �rl r Sy�!"K i'. ,'S t �. r t 7 Y tl t � r �{ wf-1• l r,�. 1 r'/"f` 4:3Fx fj a;, 1 r rr y.'�i' /1 :� •f t rr 1 ` +, ! " ' ' ,r'i.l� , 3J ;,Y �.•1>�j.*l.-,Y.` ��t'lity ,'�1 !f � 1, �j1 ,t � t � e � i. ��, „i f,h'r� r<• `pp+a 4ry,+� + ''[ +r iI}I :'A t r `.��t ! Ir, �rY•t�iv i�5. o S tT 1) , rt_ r 1< ,r t t - I f 1/•1 « j r '"'f �+. Jr r �' ',t. ` ,1 "% � ., .� 4f tt ern `!'Y y 1 ti, 1,'i!�>• J r � Yr� •.r , r v t t) ;�ti ►, ` w-i 3 ')Jt'•'7�',I i r•I,M ''tl,( ,•f 1� �•t rtt �,a y' � b' S'' }� � �,l h fA , :\, rW+ ".. J.,,,(, l., f 1 � ' , r 'J.,. , ,�r,•: 3,t r1 r r i6 1� -�._ .d,..',5 tt:{,'.}} 11 i • ;,�, ,,. ,,1 �' fit` • t y ��y,�..,i.i I-_1".., k '' 1 '*rr �1' .n'.�' r,' ,:: r - , +' i _ t r r•yt .I•l`I,,IS'1 (1 F,,�- I _ _ - - - I — ,0 ,"-1,,I,'�v,,_.,...,..;,,,-*Ii,1—"�I.-,,'—_,.I,.-.�,�,.-,..�"'I,�1 k��"i,Z-z--I 41�.,��.....,,....,.�.I.._',..",--`I ,;I-,,�,0'",.�I`'"i..','j,"- ,,t..�.J,-,I4.;_�- �',"I��..".�,.'�,,�-'.�,?��i.J,�,.-'---f�_j,I,�.'.'.,�-.�_",:...,_;,,,-,'�fi':"...�-,"I 1�,�,.,---_..:_"-`-i,' 4 i , f } .��1.I'I-,F�I�!I,",-.�I.I,!I-�:1-7��.i-'.:.�._I,.'1;��,.-'.-,.','i�Y1.I�7.I-`.I,I I�.. ''C +',fi7r t ,11;'/' r", .. ,1., '.I' (I. }t",.L a ,i7� f ,A '•`'� er?t Y A: h1 - 1 �i 1�_ r 1 wtyt i`,v t fir. t�t,1 r r; " 1:,1I I��A,.1;--.II1 .t1..1.;,I" .AV"�,�.11,#1�"-�f11. 3��'�I.--�1..j"..7il L-"1-'I-4�,%,.,- :• .'L ;{: " t1 t YY; 10 s jar:;` ' •ir• f 'iPifI- ' r ,, ;""�j ,.: rr'.,:. Yr ,... ,. r, .i" - "(j - 7 ;1,,. II,�rj' ,•. ' .//per IY+ I-. 1 •irr,1 ,Y {. :l .1 ! '� t1.,p'",. 1 J�1'r41/I4'. . 't. . 1 /�4.L ` )' l II r� !1 , 7 )f F . I p, e. , ,:,-,y', y, .,.,J. • 1'i,'-, .,., + ♦ ,` , tY r Ili Y/ �i.tl� p- ,J: t i,,,.�"I.,I�,"�i�;-I",1I:."I_,-.1II�_,1,,_,.,..��I(,.....,,,_I,.I"-I,,',D.�-I..II�,I.!��,�.,,�-1.:I�, I..,A'�1i,Ir-! W.I,6--.,-k 4-I-�.'I.,.,��".��,.,,--r;P,-..,,�,-,-...Ro.�.�,,iI1 I i.i,I'",�-I t�,.-.-�_I�-N-��-I-I-,.�,�..0 I�II,�,,,!-1_.i.;I;.1:1.-P1.I_4-,_1'IA,t.;�.. -.-.I"L�.,___,-.I,-.,,L 1,.-O-_,I...,.'_�,..�.,'..,.;..,IF I1a,I'!.,-,"_,If.e-.,.;iI...,,.i I.-,,I,� ,.--.,-I,,1.,,,4".IV�,,r,Ij...�-.-v.:,.v..o;,-`�I.,-t�,�,�"�,._I-,,4.F-L., ` , r , :` A S/ �M'f :. r t:, i . , -r,, I/ * ',:- :.,: ,',:..;:. :°' r _ ''r •:: f ,tit rk'' �', , '- ,c ':I r..' f: r� •, 1' i '. •.r : 1 - i •1 il, 'y:':yr:. ,. ! }r �\ 1 fir,"ii`k? i ;=r. i� ; t' t =) < • j,, rL 1 "j{ r / h tFl, N4 fr t ,L , .� , ,. , r .) 'il' t.,1 (ICI.. l._• , ^;,r,l-. r,�;' �' ! - Ji r. '1 '! , :''.,. j '+ Y 0. -j, L .r �.. ..,..�..:.... ..��.....+- . t t dC i'" W r; µ vP I, " r,. . / .. uL« V: 3�C:';.$ll i.lrLw�.r•.��.. - �..-�-rw .i t y ror y�� MI I L ri 1 1, • • tr 1 i ,;'t ► t�}5{{5 M! ,'".• 1ij! y it ,), 1 ,eptember Z4 , 19n7. ,I-"-.,,...I".-,.I.�'.�.�'�,,.v-."4-,',-4--I,--'��'.,,:J.,_,.,,3,,.-�,`-�"',.:.1,I:1-,�,_,�l.r.��',,,.�-i. t1tyY . ,� "' r,yRd� ti t , s fr. 111 - 't 2 Z hereby renounce and disclaim any right to succeed to any r, it ' i' l / s " t portion of said p_•operty as a surviving joint tenant ul>lder sai8 ;;� ' r ` ' ' _ ' l' ,�. , �" j7 1 t `� 1 , , . .•r , _f,_ '� d gra,it deed. " ' r ( iirr r ! , f r -t '. a r .+ J 1± �A 'J }f•'r } ,...1 5 HATED: JUNE 21,. 1988 J`1 +� y: ' ?4 �41 i 1 t ,s:;`; i r . I t 11 t 7' . f:. t y it Y ..�> x ..,'r, •` r e.',� ' " 1, `t r:� e :'.J r��,' '. ) •': s V • ' t { `1 rk�+,Fi 1. ,1 i , .r yr fa ,ir_ T ; i ,r (Y rC 1 Ir r `s1 ' ` '•� iy •+ i s t r 1 t +-Y t " t r r- }"4',�t� , 1 I I �' j t t 1 4 t t 1ti)' ,rr��7�"y�1 .-. t� , +• IZ %lv i !' ry r+ s_,. t •S,~! 1 , V +.t t; lYt lr _`. ." refs{ r r1 .},.,'4 1 t,txt•�: ! 11 •1�' ri}r�,.fir' i ..! :�. r� y'lf r��' =ilr I T�'� �: y�+ i { stt'.e, , "f �+t}7�� f T / t ,t," . t, I 4 rryi l.,r ' t 1+. ', - y ,S'l,,1,fl 8 JAt ES A. a 11ANDRICK, ,Sr-" }+� 1 .. ,r m(_ is h1. ,...;..�,..i."�Il�.1,I.-,P,�II.,-.,1',,,',._,.-T�,I.,.,i- .'-,"I..,_-�.,7,1""-��-,,�.*.�.I,'�-1.-1.,�!,.:1"�;_d..,-�,_,I,�;I1.,_..1i;I"---';I'#-,_�,.:T' �,"f',,-.�I,"��,1j.I�,,,�.'��t,�,,"�,'-,1,1,,,"Al".,-d...,..--,-,--,.I.t'�;1t1--,�' I T I,. I ,S:r"fs. + } `,l+ tit.�i�.J pi�d•'p{. }-1 {'L.tr�i, ,,, t!r 1 �` Iritry „" ``,, v :f_ 't 9 r �' f1 / I ., 1 /i it,1 I.. ��I 1,;.`�I,I;P,-�J-T 1,''...".,, -_1 Q�,,.',,,.I1.,-.'I zP,..-,I I IL�-,IIJ,�-,i.�-�t 4,.T,,-,,��,!.,.,,'.'j!I II,,.,1-11.,��,,4�,.,j.,:"",?�,��,_.1�:".l'�-.1� .; . � " �,- y i,i wry i 1r G" i ' ri 1, 17 fl tli r'�'V'�t"rj i.� J 4�f`• •� r "f, -t�r' '� �rq� i+ r , t r t �. a it�f ,� , '9 t i } ,r x•,4� J r d 1, itit i '+ !u. (t 1"�ly i f• '{. rY I Yl- r ` 'rti 1, • allri 5 11 ,°.}a k J }t 1 jICrti 4 1A I- r~ 1, "i ` 1 js4 nf,' 12 STATE OF CALIFORNIA ) '' ia;.'t I y '�d{` ',Jt r 11J11 ) SS RrI�, t,}A4-,'. i-4. r. ,a., ,r", .i :r A,} r �,. �4 r, 1 '1- 13 COUNTY OF ORANGE ) ,�i `, {f,it ��.jje-"t�lr <Y� , 1.. tP `+ t i r:A, �""Z(''r 0(: ''itZ*J,ti . �1 ',. "•i' f '.,«�:� I � )1 `t .r t', '„ rr j i 1 t 1 + ' +. 14 .'"RA`� f, i't/ tl , or, this Zlst day of June, 19BB , beforQ me, the undersigned, x " / 1 iJ". p t , r , I.;1.-"1,4-�,�."�r..�'.�,,1,,I,;."I1"1.:,.-,-!.�,�.,..�I',1_.,'.�,0�_�I,�r�:,_,,�._,,',,I",..II..I:%'%�,-,.-1�)..I�.;�'.,".��I�.�,�.1.�1I!I�..I,1.-�,�1I.I.,"F,.;:II,7..,:�.,I,,,,1-;--.,,.�.�.,:,I:,".4"I,-II,�i,I\II,�11�.,.,,�-�I I'".-1-I,.�'I I,I.tI,I�;,..""-,I..,.�.�.I,"I I 1 •r{ n r,�:f +,, 1" ii' 15 r�� i. r f , ,�� } � :ri,,,ri?"0jr, 4; %i T r' , I a Notary Public, personally appeared JAMES A. SHANDRICK, 'e"i- .1. �V� r' `)x' 7a'.. :/ .' "v{ I "tl"; 1 `�J 1 1,111 II1 t�1, ;:' ,, {kj}I1. 1f St,/, r 'i 'S - �b,�+,`l r ♦ 1 t 41 r i W ��• {: 16 y.� �'�'+,1'„y ,c' t J ' !J,r ' "/ I,I,1,""w,,'-..Iv",-.' I, I�1,4.,.,t"1,I 1 , r;t '_ „' t,` personally known to me (or proved to me on the basis of {I"� ,�, `t�`qs; ;' ' ;' : /. t a '' /- I n ]J JA ,ht`Y JT , t 11.' i r ,,,'.,,".(,,,Z,.b,.,.1,4�;j"""�;A 1A""...,,I-7,.,A,.V._U�,1,"'.�. i�i I�:.,"�,I.!,-,..',II-:,:-1I�.-Q'.."I��,;" •- r if, • , ") . s .v:r 1( / r` rt` 1 r',' f •L�i " •,,. }` ,t ° y r" 'r Nti satisfactory evidence) to be the prirson *chose name is subscribed 44�': f �� ` Y (r + '�1.,-:,,.I�.,,',-I"�,4'",,.v,-,*;"-1�.,..��'I'',1.-:,)_.-17i,�I"`,'.�.,.V;,V%,Wii'"_.-,�.;,�4`.,I�j.0.l 1i `.1-.,�_"4'.WC...'F�";-,,i.I�.�,-;4�;,1--"'Aj,-1,�-I,!,,,7'i,1i,if,.-,�,'I--_�iI�'1.:-,,-';.�1.,-:-�,.v,,_-.,'�' ,.( )- 4, ' 18 a yr" f p+-. d ,. r ,t, ;` i to this instrument and acknowledged that he exEcuted it, ` I:iL ;'`1 ',t', ' r £' ,rr 1 _ t •1_ f i !..,,--'-,I-1�-I-,.,�,'�',',,�,-.,-1_,r4.`..1�1-j,,�'�?,j,,�__,1.I I.4.-._W'.f.,..,';��.,.1_4 i,.1.-"...�,0_,,--,,4I"--,,t�,1,,,,1 1,1,''.1,1-,.,�;:-�.,..._,k-��I"�",..',-.�,`,l 1i'6;..,T-,�:1,1:,�',.�-',...,--,.,j',,,�-,1..I�,-.,.�1..,*I�,?,,1',',,'"-,."r�P,,i iI.t"-%.v,..I.,I-,!*�,,,;,_,1�Ii..,,�-!�-Z.,1 1,.,,-�,".I,"r'-.`�,,-''.,,-,, lU 19 _ t ,. e t � }+ftt, rt"4! : t;{� �'�7TNE$S my hand and official seal. �t3z r ;+ "<` +' t d.Y t'X �, �n t a,- --, f 7, I �%Yfi�r, .Ji •�/ +i J i {� !• `" +)X •{ �r t IR s t 11 r -I J t {,jt ��7�'+•, tL 1 1 fr�_,. t t} ' r .* t, , 1,Py�,r;,y t �f A ,rr'�11 ;'J ' 'i f [,,1. •,/ t fi• 1 7Y 1` .:1 x t•, tIts Fttl,lr , 'r:_� G1 /�� t. q :;l tif•f y� ", "" t' ' r rr sy it ,`J t i, "t i •��./ IC ? t ./$J' � .Y ., ','•fi r I1r k ` :a " t1.�! , 1 --. 1 f-%,," rA , _ (,v+"%x s� , f"+ A"t( ri l. I tIs t• 71y -=f 22 Notar Public S n : ' Y �{ x y 4 1 ) , ,f tlt ,tT�rr,. ,y 5rft'. , t /•! a it. 1, .t J`tt;` :d 11 I i, r,' / a. "1 , 5 , rt, t'1 'rt` '' ''ti C l F .1 t) , i/F . r -} ,; r 44 7`4Aa,4 .'C.\ .,r , �( A, , .• �'LR>',Y,r -.-,i t 23 t ,♦ �l r,., rj 'lfkr, }+-e". .), .1. 1{r r II t'.L[ �(J�7t.� '"rfl ,",t' !�� /yJ1�� , �.,i�11..f yt .'.rtr f,71�,. r � , r• �1 I 0.jT1 j `Ii"try ,,, r . ] , 2-L _i•� ' t 1I rS {4,, / Y* �12 '"` s r�.1 tJi r .•1,?!^ CM�L Abe p l t�; t t I;,,.�-.I; . I �.II.I..1l--,I.""j I�!I.1k,,I,II�,q4f,-1).-,,�i�--.,I�I)t,�611�.I:..1�0"i,,I.".-i,!.t'."t.pV�"t#;..,,I",,�"5x,,--.1',I±"'..:.�IA,,,76,,,,I.,,-1"j1.I��.,.-.1,.---I",.�1,�t!I1�1I Fr",.L,".;,.,A:�-,,�,'-1,.1 0.---11�_."�,4.,",':-_'�,-'iZ-',-.�$-_. ,,,,--,... ,x�1 + ,• A 11 I � A1 11 25 C WILIAM Cass�IR. tI ,I .1, i -,r. tjjjr'''��16 ,�{r�I �I ♦r r �+ {3 i •V, 1.; t If ;x r ! �►1 `1 " k, ►2.— NO1AAtlF'OMIC-CIIIFOANA , .� r t`t i`r r' . '++3, it ,�� ` sl :1W s� , �''i , A. i., n r OiAAM ECOMY� o -{ f<, Iyr!"9!{ t { ,(,x / ;t frtr, If •;r r -� 1 t ` I. 2 V '�ArG7.f3�iRf 1.2�� 1L r j r t }"5!r ' 1 i i l rt .r ' 1 ,- (r� + 4 ilt 1i s•.., 1 �f��I{e s Ir i i� i.. ,' ^�' t, )i 1 rt �"�1ir$• ay _.,*_,I .t.( I tr "; i/1"t'6��4Z •.r a,i '1 til 27 � r (y t it lr {. } '1i `( i t "" , r`1L1't +' /"/..NA , �:`! ( 't - +j :?�I /i... \{ 'r; Ir'�}r,•"T/i F}�jji �i ';,:yn,,t 'jtJ',- t` t. % AI r' jy } 1) I/ IiT'r 7; 1' r, Are, r I/ - t j s J r'. t , V .9. ,,.;1- a/ ,�ri t��l'1 + 41 �tC•y I , }r it ♦y ,At d1 r i• al ,: r, ,'t," r i t l ,. "rJ"Fr+ 1(`p, "•4/i f/ t. '4 c } k l w W , 4 7 31ry 4' 28 ItrNlr Stjet• .,}Y ; - + I )4 tyt ' ',.q I,-1..,,�,,.,i-, 4i t:1. r G •,{r1 r *- S"/"jrjfIx#M.a1;'x f . . t , y:IWI tl'f�,J, (} ,4,t `' ;tiIeVI'rlV f r{tr i ! t". < 4,r�!��+fjII xP�i,�, jf r�"f 14 zt',,`1 f,� 4•,• 1 ?I L. qi?1�), ,, ,,"r�lr, r3 i M t.T.t H St,y'r ri'4 r'ti t -- r ,'1rtI t��1'+1;f.f -2- ti it ,.�r X e + "A' q;�! i ,I;-' �A.:�I�5,'. ',� •''tj t4It1�+.. {,�� : L **1 tMt%��,:�'1';,;M{• its .4•f. / 6yjt , ,!5 I ylirF�z t' shandric. ,'t' t'�I JVt) x ", !/ r tac astrn ,.r• �a-f ° fF f; i�7 i1J1 ,Y�• +, 0 J'.e r r`;'. r 1i tt.:1 ,'f.-'• :t j, r ,,. , N f. , .y �x ti t 'fJS � J,I:,F r i�r 1 _ , , �� ti}';, _ 't4 i I , '.�7t 1'1 .r/ tli r t -S•i1 I ':,1 I. .yM 1/)` A 9 } Kll,l/ `�. t , h" , s vt.. \ r f., 7)'i•♦� rA r f Ir. ,1st 7 _,.tf -il, )r rL; Vlrr .w:'• �,� rt r_��. Yt/ , jt7 si t( 1 "1 ! . 41 +1 t3 + st 1� „ ill` r/ .. '. . vl.1f"i ". �;',. , r�w.,.� A-''-r 'f{t s :1, -I .,i !1 : t n'- ' t;' Hit• 1 �i!i t -},''i �Y•'.r � .f4 5 /,! .l (yl ') 1!1•�c�i� t l7I 1.%t I ) { '' I {: F .[It r"rt.r'' t ! �1 +.{.� ! r. •, t,,' ,, ,�,-"�-..JI,.,"�,...Jq1.o--A;I,A,-_�1.-.j,�i.-,�,._-s--.I1I�-2!�.-I'-":�,�..7._--.,,',,:-l 1:,-�,--1".i l.`,�-�1$,;I"K.-�,.,�-'-�.,1.i.,.!"--�,,.,),�,i-�",.�4,.A'f-2�f.i,I',k-,.�.,;".-."�,,;,,,.-�--".a-�.",,1,,-r11,I-,�,",-,,,__"�,j-,"'.�,;.-I,I�l 1:-.,I�.lI�,.,-,_I.;,�.,,;,!�;�,�1,;,,';,"%�,.i1,��"1"-.,:.",�O,,-.,,"7l,1�-I�i.,�'��--�+,�.,�I,,7,lI�_.f'3I�,�'��,-�I',,,,p' _,�,0.�0 1,r,I,i�",-�:'.-,,��".,I.",_1 I 1 i-.'-,".,'',,j","i�1,'1,`;�I j'I1',,--..,,i'A.'-.,�d,,.-_.,,1 1"-'�,,-I..",,.I",-,,..1!1,4'.V�,�I--.%,�i,t,0I��.-".—.�0.1,1,_�1,',1,.,,,I,-,_.l.i1,,-'"-;.,,.11,,,.,,�..;,,"�1.,,�1��.,�._��,..,5 Z.'..!.t..-I�;.�,',I"",�-..-.,, .-".--"�.-,,Ii,1_`-,,.,.,.-1.".�-;..�I,!,.-.',-_,.,,'!..y,1,�'��qC.�,_.1-,i,4i 4",..,:-.,.,1.1,,.;-1-'.�-1.*'e-..I�1"�,-I"-7--',,.I,.�.;.,,_i.i 1,".,I.��",q.I,"I:,.,..1-.",-'".,1!I:'N l.�.�I,�"��-""I.",1,'^,,�,.�..,�.I�-!-�"",,.-�.",, I"-,1,-"1�-�H",,,,,.1�:"�--i I,.-',,,;.--,,��.j1-.,!...,�.,�,..�",ii",-I�,;,,-I,-,I��".I'"��`��-I,'4_�-,,e',;.L.:,'+.,-,v�.Z-.I,,.%,,,�I�,1Ir,�,,...'�,-"".��::--,.,,6.-'-�,-�,.:�-1�-.,�I.1,�,'",",.�.�,,1�I.'�,,,.I,,I,'�6�"�..t..;_,:!,i_-..�'-7,..-��,:_1'-,,,-�,"�..,�.:,:,z.11,,--,3_l1','.,."';�,"�.,.,,,..,,_-,-.'.,,,,,,�,,,��?"..�,-I�'.-,,:-Z:,9�.i"-.-1-�1',1..4,,,",,,1�,l�,t I9N.�........,..,',-;��I.i�,1i,,, ',,I,��_�".�_,I,�,�1,.�";.,-�..,,'("l 1-111I''.-4.-,-"I�"'..:-..I.I-,.�i/.'�.-,I�.t�I.`,,."l?,II-,,:��.I�i".,",�,�7 1,-�-I'�1-'1,;_'I..4,,i.,..�,e. �;.A_�--.r,�:,I...,".*Ib,�t--I,,.-I. .I I,;,I�I,:�.,I, .I.' F��"-.,',I,L,�,,...,.�',1",,!,.�.,� e t1 1 i t i t s fl it rfi ,: /r l:',rsr t{r''3,rr r r,,b.1•".;'•\, . .,.,,L.. ., r,'1s_ i ! !1: T 1 .t�r l: 17 -.1. r�•,.2Y.i'�.t,P }Ir' }�..y `, '`t`}1K1�... 1 ;:, tt.- - �'..' t .'.fit- r 't ar. 1t ' ', 3t i( S t{t '- jJ I. IY j'1i �,.,' i �1 s. sc,..�. �,. -l YI-• 3' `' ,s i It _ {" ��:- r : ,.f L( � !f , h .a 4:jj[ i , .. 'f.' .�I I I r 1. ,.. `1 1 h; -•, 1►., t v' f1' , i.t , ! 1 t -, T,I t t i ',. '71 iul' i r .fir :1 ; ti 't`, • ,► 1. ,,-1 ,' , �;.' t f, fit! (i' ."I , Jy S." t , i• rr:;� r 1 r.l a,rr, ,{ t f t,+'.' 1 , , ? i �`,t 1 + ?v.. U It r GYt ;r)iii,+. ` :1 t~ ,t{.'.' J't ..l .;a.,;i,, rt._ '.,;< S i.:] r .�>y +r �ti A '��''.%'t,t'S` �\ t ,�C�CI,I,,yI lAt r,:'!'' rj"i:IS I��rY _1,.-, t,,' .'.1,. tR,, '" tif' ' 1 :t. ' _ r f,i. r ! •4 f;•*• ,r 1 ,�{t,a/ 'i-I,,6,x'. { `Mtif r,{,.1.jy`, , I,,. �Z; ) 1. 1 t r) j Yt )' ,1 S b r.. , .," ,:J-1 . -%, A- ,r 1- .r 0, ., .: ��ri I .:.��h41W. + �1. -� ! 1.r.t 1 5.ti ,i rr r +i 1'J ..•, 'r n .j 1"".v [x i. tf:,i:, r..F , •.t rYd 1:1} C! : T f {St 1':1:, . rat.. t'*�({.I '). 1,A,, l))T�,' " 7• i• `/:, ,t '.' 1' t .t _ + 3kV,"�y 1.T•1';��• J. �t 1< 1. ,l , 1 ,; 1 { i l ",.t}E d,-'.'" ' rAt. , t,,il.l,r t . , i, s ; _, , , ,«,., t ' J;.�j�,l i ,1. � ,. ,5,;.•.� ,1:•r 1.:. {,.. -, / 'I« 1 r ...I -;' ,.; ( ,% , s. ,, .1 •?i, 't, 11 /.. f.t ;.;J,;+i ,.r,c (t.. ?.. 1{ i. ,r 't' �..- W'k w1i14 �.V�l�••l, ,•. f r.,:. :.;14 .•..Iry+.'. •,r t sr .{ 1 ,• •� �s:d,.K, n' L• '1'li'. e ({y ( } ,.. , -r.. : .. r'.,t:' .' - . ..... .. :i. ' r 'rt f'1 Pi,, -.. std , r%ft ,r !,.,, 1 .' :l, ') r_ , 'i: r„'..'. 4. r X.' ►. :. y. F 77rr , 7f...+, y(.,; i'1 ,.t fr. 'c tL' �1 r' t.: r cd1 � .77�. ,7.1. - : t • $ c A. .'-,• 1i�.::: ,/. ".-)`..,, ; • � „ -' ;r t _ .-� ,i.�,.: .r'.;11, ,� .,rr. 'tr AJ',{ _,:•• y Y r i, •,.�-- s-_._, r.' •'_ '. :. 'is ., i..: .e:. , �'� ,.,,•. .:.,.if _ s 4.11.,.E c 1,?-\ rt �• , , j,. .I; ..7. •" ',r'.11.' :.r •,` tl 1.1 r•F•��. r.q +' {'��, il;' JI a1. J;' ,J !a rr� .'v 11 'r '1 1, , j� ' ;•-•�_.•' ", ' iq,">!" ;i�. i _. - , y k �l I JI I � * , ( - , ,•r ,i �� f � t�r ' F,1 f�• Lila r`�'��' - ,i (;f i') , 1. � ?�'1'k•t` �'•i r ►�f a �, • r 9.' �' •r 4 t ;1 .1. .i' � f 31 ,f {i - �•' , t7` r+ (+i', t 7t Tt/- � 7e�,i I .1 (( #L i� 1� `,r 1 '° ,1 t� ,r •y t 1,J , ! •' f' ,� r• ;1r �i I ♦I rplll _ t .+:! tL�r �' �' ,I .f.r•, r• _ �• , i r �} _ ,J f ,I r .• f // i n.4 ,y� •t ,1 p:^ IeW' �y�,,T+ '.. 1 ,•. .._... , ' ».:. �., �-.tee— .,� :. V:r , «.. 5•.4 ' 1 ..{.ram -M wr f,.� , .e•.:1 ,i ti.7 .� `.L .,I�a.4. p"yf •.�° ,<+!' �2 I! _,L,..ttt .u.{ S• .J_.,...•.!.`IL:._+�.�L L,�I ..\.J:,a.. ..� ,,,•2., +r.:1a 1 :{l..: fib;.21..:.:a..r...,.,..sL.:t lr:.•...:. •o•,n',, -'1 �.. F J•L r tr F I 71� �. L4 iorrrCCO s � 1 L •,WIL Ikt. CAfiLSCN, JR.. INC. rl r w �7�M 1{ 4 OIppONAL COW019A710N also .IAIN oustY i1 U 1La C.C.�a�i Il>✓ ri !'f } ,``\1 gO1T0 UIC 7 � r , 1NNTINGTON DEACN, C&UrOIIN:A 0964S t r t { ' 1988 TYL"HONf 1714) 990•141f GAIN L. t�5i1,:'1rlLE, Counly CIO N 1 1 I f sl' JAMES ANDREW SHANDRICK Attorney for DEPUTY Sqj' • r 4 1 7��a, }.• t r''%'i7t5 1.r;,>`/ r +' ;J J ! 8 SUPERIOR COURT OF TFIE STATE OF CALIFORNIA S FOR THE COUNTY OF ORANGE tiY�n" n � '. /�,• la'1yr; ,,11 } y a1' J 4 .I A�f tYY• t Yr 1 0 t 11 Estate of ) (1 CASE NO. A 4 3' 6 60 t. SYLVIA SHANDRICK, DISCLAIMER 13 Deceased.14 ) ► ysi s'' ,.Cr. '.M� •� N g :_ ,u,; . ; ��. • �I apt ► 15 I, SHhRON C. SHANDRICK, the undersigned, declare that I am !,t'rf�� l;'' r�• �� 3.6 the daughter-in-law of SYLVIA S. SHANDRICK, who died on June 12 , �' ►{�; "� *�' 17 1908, in the City c f Fountain Va11ey, County of Orange, State of 18 California. 19 prior to the death of SYLVIA S . SHANDRICK namely, on 2(? September 21 , 1987, SYLVIA S. SHANDRICK executed and delivered a 7 ;; ice* r,,,,.., 1 f r; � f,4r3•';'.fr t r ; 21 grant deed from heL•self to SYLVIA S. SHANDRICK, a Widow, and �{ t 22 DAM I ES A. SHANDRICK and SHARON C. SHANDRICK husband and wife as 41 7 (. I Y, : ,' 'r�; 23 joint tenants, to the following described real property: 24 Lots 25 and 27 , Block 204 of Huntingtcn Beach, • in the City of Huntington Beach, as shown on a mad recorded in Book 3 , i . 25 page(s) 360 of Miscellaneous Maps, ',n the office of the County R-corder of Orange County, . I4� 26 al t.4 sr s��l ,� I♦f s A { .1� IIf lE i t r f �1�jF��•ti ��. Said property is commonly known and numbered as 200 Hain �� :rF t�r,l,,u�y�r,• 5. 27 Street Huntington Beach California _ty, a,J' 23 Said deed is dated September 21, 1987 , and was recorded 3%R' q•�;I i �y �f 5�1' rIy~ ,f clr1. 7`y," I �'r t�• �YF11r t , or a. s �J971 f 1 kl�''r��'•�c�'".'iL�IJ1LC1rG.1„'xstk..-�.ti''l '+f.ar<l��:c`�'E.,tit•►'StJ�j�.•�rtlWJf.��1.+,YfJ`;r+l,y+S i'F'•' + !'t � tK�r)ti' � f.• 1 y 5 I ',� t/� "_:� .tr1'P.��. �"{j�+ � ! .l i� IJ j. ic! '1, lsl ',+ .I,• sl i 'I '_ ' ',�;1`,.;.'1{�',, i r, ,"i '�,f+ �,,.,t` iltr ti{I !f r:t , S 1'� ) •:I ' ,F t '�� t r;l}I�S� jFr Yi-). % l .r 1. qt4�j�f y.`. Y •,,:, ji `y. , J�" , . , 41 t 7' '� '} '•i: J5', mot; '�, (`A X+17 �`" 1,`�Sji w,.�?l~art t;lfr,+t,,.s�r 't..::'c l,. ',.-i .�.� 1�"��ti.ss c s •` { •_' ''j I r •.sA ' t •,; I.._ r i h , ��Syiis �:' ,r', �. ��5 �ii tJt -;T� •,"•''Zfr ra:'...rt.{ �'''' .F = ': I .,.t -• f'... •r ,11.!: ,r+ !r ;7 `r�'ir�Jr`•�1 u + � ` d' ': ' .•A.r �I !, t, '� 1f l.l'.. s '' 7,, J.all J '.♦+ ! i '� ay If ♦ ti. t . :.,' , ,r,_ , .I;,\ •;•.f SI ; a r�'• ? .� t of IV, I 1 �I h" i y�1��yStts[} 7 t I, T J),:tl € t r. ;� 7��..:1 ffl j l !,r '71 s t .I•tti,� 7��'r�"�yrj� 7.=I } t n i�-' ,•- r� \ •, �'rJi t _' r « 1. rP'1 TW'+ �• t. �� ` it > ! ' tr• }{ S�? � �="w ��JL ' T1 '�:(i �y1�L♦ � if t t r= � 1 � J j' s' r{ 7 r ~1 ' :y r r' 1 r r �, 1 'L t.j 1 'Krif.��„�{ywJ � .. 4J , ;,F ',:7 ills �1)y� is 1 s - .�• ,1 1 '�� r•1' 1 ,,t... ! s::_'\• .r...i, 6'� lo •.1!• , 4. GSM: •�� •� r• r - s i q! •1 hl, art a ' 1 > j.i .4l s �{�{• 11 F ' + . . J• rl r \ r •^n L.,��1 j t T I I .. 'r1 r I 1 tl t l :;•«. s� �� 'F +4 7r a.. Jlv ::� tr..l ,•r't , 1 1 ,' � 1 •! , {� !1,(i�, " T,'�71 7,, -'4(Ot i :1 f i '• .. ' ' { I ' •1� 4.♦�: ft r ��; tt 1'�n f'T' •., �tr7�,.1 'S 91•:.:' 4•. 1 •� �` r' ' ' 1' -t�',�u err .:Git{J -.�;' • „ t j `w Z p _ S l � 4 f `1 1 rt I J� N 11�• � •h , � st � 'Ll _ •ti' rr; ( jjtt ', ., A fvpr, �yt� ',;,J, rr ,, � 1 r �3f •+4ft �. trtT�. r y . 111 �,_•; _.,. ,` ! ,. . I' 1 7r' is t C nt t I 1 14 I�'. •'._ }-,'.`A .L,y 'rRI'�G� .�`, . ri t' ,r. r - I�.r � as%' •. '7.' _5 • � i4 1!µ`i"` ., .:; �.�r�'iFtfi��-4 �'e` �, '•�.�...1�/t.l�t ''R� ':�_;�� --J;} ...«.. ....«...ci�n..........y....��,...�tG:-...:;._..r...,._q.,..,r.A .....:l.e_S_.:�'r.. u.:J- 1 Y'i: ''} 4.�.. ,'�......1..,....«...•t,.. '.x.+.w .�...��it>,` ��-h ti#' � I•'IP�F/,n11• 1 ws ; , •. f 1 i if September 24 , 1907. I hereby renounce and disclaim any right to succeed to any 3 portion of said property as .a surviving joint tenant under said a �1 3 r, grant deed, ,{� ,� g '► DATED: JUNS 21, 1968 >j<�; " '�Lt ..;j 't: 'A'r��c�ip T i ,••.j� t_1 r'}r!f A-rJ�;� .,'y'�� 6 Al 8 VSR ON C. SHANDRICIt t� Y rl STATE OF C•ALIFORNIA, i y '.` 'rl f'1 r�•,t ,' 4 �.,. 1 0 y SS COUNTY OF O RANGF 12 On this 21st day of June, 1988, before me, the undersigned, a Votary Pub]i sappeared z r Y personally appea d SHARON SHANDRI r ana.t y re C. "t :;fy L�{ �� t �; r 1 •,•f! i s CK, f ,� ��u� •� 14 personally known to me (or proved to me on the basis of 4 � � f��•yy`�1 �, ,' t'`7i `. 1.5 satisfactoryevidence. to be the person whose name is subscribed t= r r � 1.6 t this instrument and acknowledged*,Y F `` ,fit;t�•s t=. t ged that she executes it �Z�-, ," ;;rat 1 ? ti w �.7 • ,r WITNESS my hang and official seal.o 19 J l`l�AAIIAAAA�, 1 r t} Ndtary Publ c 20 }ti•C }I,r 21 2 4� r r 11 r} l?1 lf� T t { , '1• 1 I �J (�,•: I't tr rarC�,: . •t rx'! 4 fr 7 ' , y p • Are 25 1 y y Sf tt '! s ! '• i�r , '' t i�' 26 , y aji tiKtl .' ,; 1� " 'r1. •r -. r tr�•j 3� 'i{;Xl rt jjf. ry 27 i d•�[ t�f! i�� i*��. 1 , Zk x •rt x 1 N Y �• i 28 { ` e •1 t r 1 � � ,1 1.' i ,jY �) f •� r • shandri .dis I ,�,, • ,: } r ` i•'Afr 6/21/88 w 2— �•• �' � '. •ram �•� f• }�Z:+r '.6 li '1 .i, r ♦r a a>t-a .t • r i s t� t, .-.• ;, 4 5 �' .f�tti�iq��'��.f r'3,''�`�, .r•--:c.�� '213' �17��•,b'•i.�_ f r .,✓�' ,f�Trfi.,7•�•�T'qt,Y t F ti r 1•. ti ,• 'rr ��y/'l j lf1{[ ` l� 1'r.; • r. t ) ; •'��, +f •.t r 11 ,}r.:�7 '.r t t_?r` r'a ..;•.A,�i(, l I �_ ,, lMyr+! n.-4, C�` rJi ' .' !+{ (.:•_1 ` J 1 ,�� + r ,I j.a •}� tt1}w� -i;,T,�` �: � �:t��l r�� ';Lk}Fi'?. j '�i•�t� 1 r� J I - �V r' S t yy � f` "i 7 I rr , r •i 7 1, Xr t • -:_ °y r,. �� µr r , .°`, .. .' ' ' " ` .. r C �,, r� t .., ••{ 1 �rli i { ill' %�M _'' •t ,j`Nt•.T. „!' ,��r! ':J ;�A 4 ' i ` ;r *i. /i} il'� t f,• J 4t,./ »y; �� y�, +'�'4';Qj ,� 7. f�' 'r �d �:� , a '� j ' J _ t _,• '.� la , �� J :��'K � �� 1 :r 7 ' r r ♦ r ., 1•. r a`i L �r i r r � �r , tyt, '' ff•,i .! ' fey i tr f f. , r , �i {� 1 1 * R ';I r �,:,• ,1 t o _( ., 1, .' f ,�, i !''` C rTf �i`h*T , r 1 t _ is •� ,,/ � 1 •.. ',, , , �� .�' - art• .� ,+' ti�,p • I is J�h" �� ,+'' '•'r l J, l I'r J ,> >,. ,r �( '��'a I,, ', rJ, ,rr j rT ;.� t r. �•i rrl 1 1 � r y { 1.•J 1 r T •a 1i ......1.,r,..'r r.i: " .:'S,.C:s:i'•!'.tict, .,.+ti:i J[�'7.,,r.•.. +w,:,1•nw.w.,,•I..r •.�...,...., r._.....�.rwra�oillY7At3.:.nM:]'.i�.f+c}5� � J R QUEST i.._,)R REDEVELOPM .W 'AOENC`l ALTiON Tt S August 1S, 1999 i r '��51 , 1 ► Chairman and Members of the Red►:velopment Agency ,Fy , Submitted to: , Paul Cook, Executive Director?.0 . g/��/8� '* Submitted by: /11C Douglas La Belle, Deputy City Administrator/Community Develapmcn Preparod by: 4 t +4 jy ±i r AUTHORIZATION FOR THE ACQUISITION AND APPROVAL OF CONTRACT OF Subject: SALE FOR PA,ZCEL (APN 24-147-10)SHANDRICK Consistent with Cemicil Policy? ( Yes O Now Policy or Exception , 1 'f �,L�,•, ,r�; , +, . Statement of Issue, Recemmendation,Analysis, Funding Source. Alternstive Actions, Attrchments: �L,LLIJ.V.�I�i .L.]wV�: „r} tit r'�(' y1,�ft+,�+' ;°�� lyit w,.r•'1 1 •J ' The attached Agreement of Sale Is in accord with Agency action to purchase properties on f',,' ', ', ' ra 1 r,4 awilling-'seller basis In the Main-Pier project area. The attached agreement of sale ►; ;, ' ,J,4' � �'; JJ ` represents the purchrse of a vacant piece of property by the Agency owned by the Sylvia -r' Shandrick estate located at the southwest corner of Main Street an'J Olive Avenue. '•" rl ,' f S 1 , •� Authorize the acquisition of the Shandrick property(APN 24-147-�10), Lots 25 � 27, and � ►i ' i�`�t'; t ti; �`� approve the attached Agreement of Sale which includes the follovring points: ° { ram# .-*tti,•: ` 1) The Agency will purchase APN 24-147-10 legally described as Lets! ; 1 _ •J 2S and 27 Block 204 of the Huntington Beach Tract: recorded in J Book 3, page 36 of Miscellaneous Map. of Orange County.for the !r riegotlated price -of$380 000. �t ' , 2) The Agency tyili pay all title insurance and escrow fee�a. 3) The Agency will provide a letter to ,he property owner that the property is being acquired under threat of condemnation. 3=t' T;,� ,; ra,4t •I C r ,j ,',t♦ �' JJs 7 � 7a+ r� 4) The Agency agrees to a sixty (60) day escrow or less. - , The Agency authorized a g Y ppraisals and negotiations for the purchase of properties on a. 1�6'• •'I� � � �;1 •' •; willing seller basis within the Main-pier project area. An appraisal was completed in �'�, l + January of 1987, and updated in July of 1988, reflecting a fair-market value of$323,000, We are recommending the Agency approve the acquisition of th's parcel at a negotiated } ' price of$380,000. The,additional cast will allow for the timely acquisition of this vacant piece of property and facilitate the implementation of several Mzin=Pier projects,including our Main Street second block project. } ! P J J t.l x� �lM�"+)r IL f•s �' �,�r f j ➢ j ! r Y 1 t j�« , 1� � ` �5' ,;4 jLt ,a��J'' >, ,il �/�5.../ r � ,�7!>t 41y��4 ' !�' 1 u s � l •1 a,dd,J• !. �'isl-r t r�� = E.t` 1�i! //� � . ' � ' }.1. ..+ ��t:r� '�� :� ' ` �-#+�Q'' ,c 'r!>J V-,'n , ':.'s' Jam, .,r1.,.4`ra:�' t� X•?? •..f a ��3.r L�• .�yt jY•'r t` �.'tjt,..4 1 ��`-•,c-G� � �� , N"kcs17.� r'1�' S r ��w'4R,S'._ ! 'T 1:•' ,..1 i'r ,!'.l Yt ... ,,•.,•vti,r- �.. . tl n ,�>'�+1'dS �{„� `(1 `. ', «' ,1 J�SI � T `q�•r�SSl �jQ-. CT"i �S{' at ....�� f ,+j'"' T. �+tr� �� c�`}��} '�I �� !.1 rr tL:j J t t 1y.11 � T,. .;\:ri. .• rrs R:tkf7.� `t'Yrv.1,l t 1:_ +�^1i C �/1i� � .�_! 7I t4 wrl4 rl�,h l r,��s•.x•,S,tr•ii�if �4:;�� ` ` �( 'x �' ' r • f r j« y:r y , , 4, s,f•'! ,,,.1.., .e..., ,: ,.: .. .. ,_ _` .. � i..' ', .r J L i'-:.., ri; 'S:"t 1, ,t. 1 ,t lit.. r. .1 ,r. r:'j. r j':'.. y' ,'a;,..'t ,u .:,. _,., ,: .., :,,.. 1 ;, kL l01 ,•;5;: : t ,'r, t,r�,. ,.,:,rt') vJ..«J: #:-'1 'rS �Sd ♦•.+-r..:., ,.. r) .,_•.rr Y; ..,,r .. 1. .r,;' ,. ...::.:: � l�ri',. :YJ ;��:.;f. �-: t 'tr„ r�t ,i. ,5 � �. y �• y r is.{\Y:f,...,. 't•:;,yr {.,,i..:. r,;',•,.. .., -,•, + .:,',J ,,. ,','; ,. ''l;.T• ,fl { i•'•a�4 j-,f 1':! ''� �, r.l; ''+�a'•K �. .f.,:.j .r"'+x! ;•. .. -.. ,. .::. . .r, 111 ,• 1 r.1: J,J`. t � '•i.. �:,5 ',Il a. 4.,, p �a ;o .; ::•.S,RI S}-;•s' i : ,'r.t,' •,.: <f,, !, e ' + ! 1 1(, ��,.•+Y A��rl:f: S-sr.. J� - � <•.��:y-.:� 71.f . ,r ,- .,: J•1_T '�\ t•t •, ., !: » •iF.y��i�r 1 F 4 1'i%i.f 4F' :S: �. .r,, •f a1. ! /,} !J�t , to , . r . y' f 1 4• .,. ;• ,:' t j,:?r ,, ,_tom ., ;rr rl, '.,( i—t.'r>'�,Y'S {Bair) .�,".,'�',j ai.'.i:�i:, ,'.; •.. '... •' 5� ;' F� /•..i'. ,t>/ ,17.•� 'jA' �t "r' ...1;,'; ,i t.f...rr• . . ,, -tic_.: 1' .,.r :1 'lY :�, .;j`.• ti ;�� t '1,., _ 'a r. r 9�' 3'�r�„t r'?J ,,. � -;,, .t!: Tr �91:,,t ti , ti' 1, •�, rt. + ia. '7)• ,,.:�,i i.t..J,f'� l,,•;._''- .. _. . .. .o. r. , -.1 7 ''t .'e :�l , • 'k J ',d 1 t,•' J 1 r �I ?;JY ,- r. F!, 1 0i..;�,-,,:_,'''�.�..:,,:,-,",-,;.-'-._,,ij').-,,..1-,:I��I,,42''",,,,-,,;.!4t.,.w�"-�r-��,",'�1.,-,,r',�";,.I 1,1,I,�t.I(�",.I1,.�-4,.�I�,4,...-,:.-.I-.�I-1I:1.�,11 I''�..I,",,.',-�",�,,,,�,'.,",',,,,,,'!,''11,,",-�,I,1 I.-..,,�.--.. -_,/,�,,.z.!I`,..4 I"-,0-'1,1.',,:�,�---"..,-,�--�,�'.f,'�1.,,"�-,r1,-�,I 0i.�1,_�-",."-.�,:,",,, �,1.t�,.I�.;,',I.�.'��I1"�i��;.,,,.!-'-�;1..,--s.',! ��I.'.�';1t.'c,I'-�*,�"..V.t�-��1,,*.i_,,�.I'��,'--'�.,;I'.'rw�r,-,,.-''�;�,.,--.,�',;,--"�,I.,;�"I 1�-,,'-l-,I...--:,_�.,..�;..,''-:.1,,O,h".��I,:�_1,.,,"1-,.,�.",, ��",.,,,-�1-"11,I,!,,,.,,;,.!1 l:,�m 4,�,*I,_i4,.,1"-,.',.I,_,�,0,,,"!'"e.�I1,I(',,,II..�,,-P,;,...l,,,;:,;,1�,,...rr,,"_,'O�--rrM-.q,.,'1-I,;..,,,,-.1 t-.��,-/-�.-,�..,'�f:�.i,I-Iq-I,_1,I"I-*.�,,�.,.1.,-,,".,,,I1,�. ,1-,1;"1.',-1,,1.�'-1,_i".-1 1..,_,-Z.,.,�I�;"'.i,`.I,,..-_,.�';�,".I1�.1-,-�,,;'-�",;�-.i,)I�.'C.;,,,-"�-1 1�,4..-,I!%-,7-,�-..,",�.-.1,-.",1,--.,,�-�1�._1�;,;1j_"I''"1_,4 I-�..I-,,II--",-_�j.--'-i,''�I.4i-1''.�,eI-i-,;i'','-:,I��.�--.!.�j�."..I'_,,,,"..-,,�,.j.r,.,.,-.,r-1 .'�:.�.�.I.I 1_-�.",,",_:7I,� t li . ' { �.�. .,,..II I�II��;.. I,.I, I.II I I,":.II�II..:I I"1I.1..1f..).. .-I 1�-,,,.,'�I.:-�.'.,I,"�' t:• r,• ti �) ` 1R l i • r A. .r `.. r �-�"f�-!�. 1�.,.-,-;;�,0-�.'--,,,I,"..4�O'1,.,,-,-�,,�"�I..I-,..;�;,:,,,*;I,',.'-,II�,-,"1 4- 1 , ;/ I� . . i 7.. I II.;II�,.I.I, � ...I).II.�I."- ..I,,..-I.�.I II..I,,.I II II I-,..I.';..I,I,.fI-,,I 1:I.��...-,":"1,.Ik�.I.I.�,-..�:.�:-1,1I;,:�,;I�,. I.�I-,,;",?I,I,�,.:-,.-..0_I.�4,-I.,II,�,I�,�.I,,��,.I I.�1,,�,.�I--,.,,j,,-1.�,.1;��'-,��*I.I.�,.)�.I I.�1,I�:�,.t .I:I iI*2../i j_..1 I-.l",1�-�.I,.II, ,;,,,i,-,-I.r.-.b I.�,,I.-. ,.I-I,.",.��,�-.*1,� .,"Ii 1�. _I.I:,?�*1.�0", "6,I-�.,..I I�'I.,,I -1,'1,.,'1-�oi7,,,I�--,.�,I I'-�,�.�,II�I ';"J1,AI,,_., ;,k�.��,.f�'1�I .�I jI.., :.,i lv'-".J,. yy ,, t r j !t %- ,FI�A':,i. %;II.�,*-...-';.%IC. ,,i.,.,*i-",�"-_-,�,,71I-�A",. C �,,.I--I"-�:::,.�',-_I,- 1*..-,;j.,��-�7� ...I r.,,.",,-,41`,,*�,V.".,--�,,.-I �.I... �",�; �.,�%.',-.qP,-,!.,!..% j��.,,I..'I�-I..i-�, "-,',.I"�"��",j��'"�,',,�,,.,,, �.-��,-,fL',.-I.��,.,',�', J,I 1.,;', �" 1..�. I,-I� ,,"I-, f,fs.1iI..,.s,)II I, I-� l,, Ir 1 t 11 ff, ,} !' r! J re , /; f' +fir t - , . r . . _ J .Y ':' i. •� 1 rr C t P >,0�1 ., j It Ft .-�,;"111...-_I j,I.-!:%,,.I,,",,,,-.1"%,f,,!..-,,". .-,�.I..",",_I�I:,-I:".II.I1-I,.-.:..II,-�,...I"-..,;-,.EI,I.�I-.n--,;�-..�I:--.-.,-'1,.-I-I�I.-�.1.I,.�.II,I-.�..�I 1..�.I--I-..II-.-�..-�..I.I�.,.:�-...1...I/._._II-I.I,,�..I I�..I..,.-.I�1 II 1,-,,I,Ii,)1�C�E 1.I..:I Uf.Ii I,I.II,.E%�I..rI t,...I��D.I III 1.,I'XI��II�;I.I:V 0��II',I".i�I..,I,.,I.IS.,I�!1D...I.�),-,..,U'II..�I-RI I I..-I I,,I.I I.�-�.-�1-I I..IEI I,;:..:,-I 0....I�I�II I I I� III I I."1�II1�I.-.. ' ' ` to :..;�. . a f"'r dl/'+ '1 ,'-. t _ - ;I 7'.,,�-��',;''�,1",f.I I.1 'IS :i ' :Y f ;0 ,�4 i- ` tf' { >t.:a ` :< -,' , -{' - '1 i'.. rl. rr ,, •a, �` t .' rye if•'I .j -_1-1,.,..--.11"..,,�,1(.0'i--11',1.Ir..,3,.1I.�-�"..!-,_-,�,,I'(,,,t. ..-f:.,.��,.--�-i I,,..1....II. I.:,"l,, .,.,,,l-.-��,..:-.,,-i-I.I.:I�.11I�-�'-,.II�.,..�I�,��"�,,)-�I'i,�I,4_g.,i:�I,.��,�4.r.,1,,-��I:�,�,:-..,�,.-',I�I I i,-I-�,..I�1I..,,,:,,�.I,1�.,��-�,.4.,.,�I:.- 'I III.Ii I.,.,-..Ii f ,I II 1II 1.I-...".i.�,,...14 1.,..� h 1 1fS, etN� l: ( *ft.1 ? :r1 d 1, 1 1 t rt , 1- l r, s, 1rr t+t, J r, 9 s "',t J ? .41 7 l�: ' , br t, :{ . ,.. t7 -i Y' 'r ."J i =, } 1 r,.;'t v• r : PJ s' J .l i' ; F„ 3r. ,Jr j/ t '' ' J, t .:.,7 'Y `'; , •': -.^` i 11 .,r.--, ---'i+'rG'sylriYY ,•y r,. ({ t 1 �jr�� ''��'� e t.:!'. tr.,' ."`,F 'afi/ut'•c. " ti, f„Yj:�r).i;:,.•'YiLY...... YL;:,J._.i_., A,..-�:w1w..: 'or.. r.-_..,... ..r ..,.., �, r ,1 J ,t, r. , •y�+ ,. ,+ I 'r ri ti.1� t. .t • .. .f •11 2 l r "1 />rr F j ! J N J i L tr ty- r/ ' it J _ ir�r 1+� 4 '� ` t.A J ' i' Account No. 812-601 `�" s `j , �r ', -; j! r y j ' I S,, ,♦ I), .!,; i'. I�I I...��-,I,,-'-�-�I",..I-,�,.,I:�,i.'I,��.,-.-,I-I�I)-�.,I.-"�..�, II,,'--II�.�,I I-"-.,-,��.. ,�.�I1 I.II.._.4I:��.;7I, -�-s,I��.,,,,�,I'.,1:,�,,-�",..- �,;-.�.I1 ,,�,'l,,-1:"C-..-!-";.4��c�;: _.I�--��.',.I--I_,,-,.�..,�,`'".,'+.L-;�T,_q:',-1!1-1,,.1I 4�,,�I�,.:",:I.',,.�',-*_!I� ",,,�I', I2..-;,;""o 1,O-.,.,w��- _�.I','".'.',.,�.I.-,�,...:".-I,,..1/.!.1"",., ,.,,'q�4.:7,",i:��'-j�,_-,."4!r.,-:�1."�I.:,,,,-I,,.l II, (i j�O ,111 r ( 1, l/+ 1+, .. ! i t' rrlj i.r', ,rr Ll�BNATE&��]YrlIQN: 6`i Q 'r t; -fr 1 ( + r .Y ' J�hS,.i ;"",.l,1;_1:�.,-I,�II,�1,I,'-1 I,.�I,.I"-I 1I,�,-1.I.I.,.-I,..,r,,1,,,.�.i�,.,,..,�,.",,"-,,v:,'.I.:..'I.,-I�,!I.,l4..,,_1, :1."I,.0,.1,,,,��-'-�.-,.,;�,1,,,-.�----,I 1 I".11'I",.-�� , 1 ��w lr y�� 0i, ,.I1 I,.,3f�,!��-�I'��y:,�,.III.,,�I I�.1 I;I iI i I��i;I 1 j;-,.�:,0I--, !-.1''iI-,1��k,'-.,��'*I"�.,,��.-;;,,,��I.,.`�..�,,�.,,,,.,�I I;",,�.-,,"�,�.,i,.:�.I,�,'I-,7.'".I:,r' 4,--.-1;,..-,,1�,.�,�..-,-.--..i'.:,,_�.I,,1 f,;,..',-,..,11.I1�-�Ci,",I.',.I.',,,...-..,'i�.�-,,......, 1 ` " j}} 'r _ , Do not appro,te the acquisition or modify the offer. , , w , }tr t > y p 1� ,t irr t,.�..� - r_ �.��+ 11 l; } 't t 11. f 9' A37As.�.�: a 2 titl�, t tt + C 2 +' . ; 1 :,1 i �5 W t 1) Map of Property . r, 1 2) Agt eetzient of sale " R:u.f`' , , .,,; {ra�1 j - �N 2`e 1 a M i. + �1 nri'1} �d,�4��i� , rit ,:4rt'v�'f t r' ; tl (i: L , », J,Il , ''lLF1,1 tr_ +. r JF 1', !'� '. .�II,I,,-,,,I�;,IfvIIi'.1�1".F,�,.I0'..,�-�-4.2,,.',�,.:�111I.,.i..,.I,Z..__I l':',.1.;w�I-I�,I'1�,,'��,-I.,,-"`��1,�,i,:jIi-,I�I 1:1 1':,�:.�-"i1,-,.�,.,,.I��.---—.4-�I�,,I,",I,,,;I-.I:'',�,'I..iI�g-.).1l,.1,'.�',I,,-.I-.,4...:,1-I.,;:;,I1.I-��."-,�1,1;1".I;.�',,,��,��-:��9-..t,,I".I.--.,.Y�.".,'-;�,,'�I"-i,,,.-1'�,,):I-,I..�!l.;�,I:f�W-...-....1�*,I�_..,�I I11.,,:,_.-,jI14.�I..I,,,.,��,�-.II.--�1.,.,,S- rl r'',. r t{S�` t•l `fl r � Sid 'N r I r 1 y 1 ;4111': `,� I PEC/DL13,lp �1 ( J ,r r, t 1, 11' 3968h r • ! f' -:1• , Y1 r r Tj ,.. I.r,r,q i �J ! �r f�'� , j a 1r l - ;1 {? } ) 4 y .. 6 f 1 '+ d { rt + >tt 4 r l ) t ,,Ir +1 j..,1: , J .t'1 t> f� 1,14, ! J'}' ij� i jr r ' t< ",? i' rJ i+ y, II ti , Fr k n' + 3 rf+3 '.t �r � , -1- 1,, - i{ .F i Its 49,,r }.4 r it t Y r 2 1 f ; ( + 'jn ffff 4444I. t r , tE ) y+� `t �f t yyI rt{ tr': < i(j-1 ',t C'h i•- 2��'�'('-� ,t 1 +'` ��♦ t71 1 S I,f. , t :�t♦t zl;i I. tS rj( t ,. Z + k `,',r 1+ ,iI r1 , f HIV, i T} /lid, r r . 1' 1t„r r T I% r ,rJt't l t�l T u s'iYt { i t t, li.t fr i1 .4,�1..1"j it P�1�'z4�-��."_.I.��.4�:I,ri2.,,.I�%..I.,,,!--','%!,,.'I��L-I:,,.,C,..I1�.#'/-�,1�I,�.,�.I,�,".,�.,P,�I..,-'I,.';I��.i&!';�.1,��.",,,o;t-I',,�W0.f,,,-!tI.j,-.,.i'!t:�.j��^�..,LF:,.q.�,;',,.---�.�,,I,.1'`I'.--."_".,�.-_l,',l I-�-,I",.0,�,�.I4.,,.!4V��i.I�.1-.",I,,0.,X--"-,,,I�,,,,,1.1�.,.1��,t,I,,irr I 1;.��, .�,,.�I�,,._�-.�.-..,..,.�l.1!,i.�,.,-�I.,,..�',4,:;.,;I� ` , 1 I , . ,: 1 d 11 rJ 'Ji. 2i, e ,r tl !r ,l ,, i I;` "r +,r {' lil '� } " 'di, ' ` C1 r^'17,t,1111�L'.+r. .. �"..;�.,o-,,7';I-�4,.,)".,�:I t4��...-.I�',.,'lI.f1.,"i-r.'.4 AIA',1�'lI:lA.'1I,J,!,-.�f.4i,1;l.Il4 J,O1,�1-�1..,I,�,j-.,'A4o I�.I,i.�.t 1 l.*�.*,'�l.1,,t,If.1,t,1!;, ,i 1!.!,, *.I�.�?,.I�"I.,,,.�I-I,.:I.'"1:.,5,,,,,,�I,"LI II!�"I,-,:.I I�,Is,,,.I;,,4St!1II��.,,.Io tIj1 1,,,..;,-.:t!,41,l,",,.I,I.�1�I-,�I,...,I Ir. ,,��"-V:,,i l,-I�...,�,,-I�".�."-.,I��,�-�-%��"�-,�lI.;�.,l II,I'A�..-,'-w;(",-.'I'9,','-,.-,I-,�.��_,m"1��,".11'1.4L-.-.,'�-,t,,.-j I j 7,�._*.�,"�",k.-,,tl 1,.,.I,,."..,i 1-1I--�--V.-A,.i�-1,".,,.,,�!I,.,4,;,.(.,."l:*:',1,�:,,�1"t.."l,1�.4,.,.I"-.I-I,;,'4,"-,l"$i.,,"I,,-I,,1-�,1,,.:,�:M",II_1.�-1.,',.::::-.�v� _1,.il,.-U,.,�'-,,�4�i,,WII,.�.",%1�N,',e,,r:�,,,�,,.�1,I,1-�,��,�,,,I..l,-�,,'0-�,._,I'I.�_-'�,I1"(1�.;!l�,�...�-t'.�.11�I�,-L 1I,�-�:,z,,',-1..-.l.*1.�t,,.j,-"-"I,,�- .I,W..�:-.�..-:.�I.o.-.,-Iw-I�-;�,.__ o1...,"0,�f�.1.,,',i,.".1�!I�I,,.,,:-"�I�,,�.k".",.-.,..�I /ar M r• 4,. s { a 1 ',t , y1.I,♦ t,, '/ r� )t:1t J. 1 i, r, �t ,ffr j; r r f'' tl ,.- 7 f r ;. s cI'R C, ` {1 i r.4' . , 1, . . Yr J'-,` , ,jIf%:; kht .4j,s.l' !jt �7 , r i J y , il; r.i 4,1 t Ia, rt, i 1 i,.' 1'� '9 •�3.k r 1 . 1 ! � 1 . J (*,;', , i' •�. yyy y-1, '1 7 , i, l l w•/ 1:f I 41'l S.r:, 7, .1. y i F.{" k .n II i r .r N ,+ OJT r' c t, y j. I t4 y { t, *r a*♦ r . + r t'',, r �r _ J. Y 2 1 +J i .u. ,51 t 1 1} „yc y,..�= r t� k. 1 t _ `.1. 'l it ,r IY. '. ( ! a7h fix' � ,J tl i.• tr r„ J ' rI . - 3 , 1• , $, u l ,y r "' r,C}Y, , a ,.t t " (} + rl� t, -' •j�r);«r4>'_r )!..r r i, Si. 1 s JY'r"�,'II" 1 r.4`',t{r„ i},i •Y. „ ,.., r 2` .'•i Y>,.I a',t r T � 111�f t r r -:,." -fj l♦ f/. ! Cam) D / +� sl r t „ti s. j,} il. f , 1 l ///}}}ri /t Jrrfrji�}Jr t 7 4) i l/J� •d"' `I r { r ,7j+. � y Je�tr„ 1}� fl: + j 1 1 1 f J jlY { r " r �,) LL hIr�t1T' rys� 1 t;if , )=<Stt. Jrt� y,r��.�iJ 11 t i} �5' {jet ' ( i:1 J'♦� IrT+l r'ftr��,,"Sal j.~ /f, 1. ♦rti r �{ ty IJ .{ + T! f-` J'�R y7_ lrF+ i�{�^ f'+ � j'. tlr Crt Iti '/'�` �t�,J. X t:C ♦YLr ' t �/ t �H a�}rj l }lly Sl ' '�� 1'j1Yj ;}ItiwCi 1,�, t i ;J As�)I -1r.Js �.ti 11.k' ^.: 'rjI--J(r aWx4: w7wv1www 1vI"- ....+rr�swr+.. OWT �LifRI.AKH;:�;tT'sr*as, rI. . rpM►v!, , `J,_r" ,. 1,, .�1.1 1,Wl', ', : hhh,��,I }Y1 Y C f�J p}r i ( { ' .. "+: r i /i r i r 1 1i �M.•,�. r �, L d `J,..� i �� ;:.� , .:'',� 1'.:i4 r:'� ,r ., r` -', T• r• t .} .r': ' :fl' / , iy '1". .'�; ,� / .+ C 4 f f-, ( L r`:' .' ; ..t( ,y J jr:_ ,.. , ir: S ,, .'- ..•-r , •, Y', ', 1 1 �; „ -0 t,P r.,. .•.; C .n,ti ',t'. .;I-.11. T,, ..':. i:.,�, 1 '... t.. ��'� r : . .i .�� L.Y. ) d'- .ly7P� �.. ., @. r1.'-f♦rt`. ..i , a, , '1: * �r-.:C. Y Y1 Ii jJ,, - .f. ,.t;%• .rk ,. ; 'rdli ..:_. ..:,I. s .{j. 1, e. 1, .r, :'�, l r. r , � w._..r1 ,YYt r F 1 fly y,. 3 ' 1 :. ' r.' ,yy rr y { w' �y i. • r. ,,l£ r ''• -r' fa ( .7•r ..1 ( + - ,lY tilt y7 r Tr..2 •�R ,+ .1.y j ,t t A r •1 7 .�. 111r;_-i} 1-.^tom, - .ice '.1 J' )• '" ,.-r C t.r• S'•� rya, L, + 1�' ,' -ti •IY.. t.. ..!_'., Y.ki{,:C �:.-:j; {I •, Y•r, '• 'f1 X1, , :_ " '.{ �1 l j:'w J'. .,f 1 "- ,,d Y�.r .. .I ''"• r `, ,!. sir I.rd t .1 j,r, �•,:• s 1.j ` ,r } tf nPri, �,r} r. '. ,., :1. .1ss1t 5.. �V.jji,: , ri-f •t!! ,. , / ,li , -, �;) it •i .ci• 'ti t 4C .5,') f kA*� r' ,^, t )�," '.t. 1 j 'tTC,'' of,-, ;,':.:^.L- � �. !-�1 t). ' 1j-, .) �1 r ) Y �>7� 4?.11 r,.e a i:,-i2.'t �i1�,i ,y,;,is -r t f .:i .. �J �/yyl ,'.! tyre Lrrs:-�1 : fyI'1 . t.. I.-':; _1�: ,, -i -)' r 'R_ , r1 j ,Ct" l� fi.'_.� I ' iL. gat '[y.�h 7t� {;1 .1• tr�i: tJ_r.t 1 III t� ,;))(�YC� J •.r._,,,t - , t• .. '.,;.: 1, ' • J yi,k „� .Si .1. r, 1 �i,Yrjr��'tsYtlr'1r' 1t r.,.S'' r •( . [rt - ,• V�If.�i �.,.t� .r r• , 't �' f. .'I ^t: ,w:=•Y's; ,.;:!_..'f '}/ {' 1 ' o. ,'-a �1', = r c ..r , :,+ 1 '11 N .mot♦ 'l i;, t��..1�r.f'i:1i ,.., lt. * f y. �''-YQ��}��: ..l;.'r ,�, :,. { '.:. .:. Ft r I, .a. y ti1.,1 +. "'.4 ':': .r , . ,y . t'� !: t "r rl ��r h. - - ,:`.2, I 1 t 1. r. ►. ,:8 a '•i'+ `Y:-J:'.f) r,.. t t t .•IJ J ,, t ynG :�Rf,.r' • �j. f}`M�tJ1,.�tJ t,. ti, I , .�.l:l .r+ ..:' ., 7L {' 1ti'- t, . .t•;: r t 4:' � ' ilt'�,flZ r„ '-,,r r.. r:, 7,,. '.' . .'•'.e t :_ , ,rt y,,,, I�` t 4 7f �1 1 r1 T'C 1 i ti (,0-) is 1 , - rts' ;' i ,"II r . . r S&1 ;-. C• Y ,r j t z . ' , ', :/ • I� 1 ' „ t y. rt ' I• `N l r , t - .a A 71 ��i 'I> 'ti,T i l - .. •'� ,1flr.ri a} + i � e tj I Al e, . %,y}- � _T` •i, � .., 7 ,. 1! 4/.7i1h' ` lr. �ii,.!• - a ,.it�I S1' ,� 4 t' _ • Y ,.. ( r,t.a y'�'1.•,,��j! ! f t! "i } 1 t f �i'� r.' � I ti i.. of t•1 i•/�.:. ,r7fl f•'- +,; •1� � 1� �rli� t'i (3i`} �� 1 y9 •.t , f ''+! t 7 �!y�"Y 1 't f IPA .r l r ,........n..■w.-ayw�clt}'''2.�'r=a�l.+.�,a+v .� Y• f � e°'::r,l '1' j': m'^ .r• M• �� ..�1 • • y �r a w Pq 21AV a = • =g r, 1 .. :: './�• ,t �•. t q• r tAt .� tit a la' n II �WUAL � 1 •�, l� l I � � � y f, ! �. • y ' 21 i i 3 M 1 a t I6pv Is i C. D� • t `!. .. wto , ( ;'S'i'•' � K !'.►,fin I I .• �. . ` �•z }s ' 2 I 5 3 s :t - 24 AM 10 13 g t3r I�' 1 �M, •i L H r • J n 9 w •.., ! t —____--�.' -----------� � + Ho rISsrnoov�a aLCf. a ASSfSsoR'$ P •• - ROM NUMSENS &Over s;rsILE/0 psi !. IJ � � 3 SMOWN /N C1RGLfS COC/KTr t7f ORAM6E '.. � (,`�t'� -_ w_. .J...rr• .... .t . .r r . . �: ! ti1}_.l ir�,.{,�a , � :, JY,.r- r"11 a •1• �� i � Y• it '� 'I•(!r � '' .. .. !;Hmmx W. E 3"• ��nfr,�j' �...:�(.,.1Y�. '.. -•"i•p.,J.tR)wr. •av• .♦. t. I �rf, , ' :;`rjn 1j�tj;� ri ;,t'r^ h. ��r